TAF4B Antibody - N-terminal region (ARP72855_P050)

Catalog No: ARP72855_P050

Host: Rabbit
Target Name: TAF4B
Sample Type: COLO205 Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Cow, Dog, Horse, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TAF4B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 92%; Horse: 92%; Human: 100%; Pig: 86%
• Peptide Sequence: Synthetic peptide located within the following region: TPGKPLNTVTTLKPSSLGASSTPSNEPNLKAENSAAVQINLSPTMLENVK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TAF4B (ARP72855_P050) antibody is Catalog # AAP72855

Target Info

• Gene Symbol: TAF4B
• Alias Symbols: SPGF13, TAF2C2, TAFII105
• NCBI Gene Id: 6875
• Description of Target: TATA binding protein (TBP) and TBP-associated factors (TAFs) participate in the formation of the TFIID protein complex, which is involved in initiation of transcription of genes by RNA polymerase II. This gene encodes a cell type-specific TAF that may be responsible for mediating transcription by a subset of activators in B cells.
• Uniprot ID: Q92750-2
• Protein Accession #: XP_005258397
• Protein Size (# AA): 618
• Molecular Weight: 67kDa
• Protein Interactions: TAF12; TAF1; GTF2A1; MED26; HIST3H3; TBP; RELA; TNFAIP3;