Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP33394_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP33394_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

TAF4 Antibody - middle region : FITC (ARP33394_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-TAF4 (ARP33394_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB, CHIP
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TAF4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 78%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%
Peptide SequenceSynthetic peptide located within the following region: EQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRL
Concentration0.5 mg/ml
Blocking PeptideFor anti-TAF4 (ARP33394_P050-FITC) antibody is Catalog # AAP33394 (Previous Catalog # AAPP04440)
Sample Type Confirmation

TAF4 is supported by BioGPS gene expression data to be expressed in HEK293T

Subunit4
ReferenceLiu,W.L., (2008) Mol. Cell 29 (1), 81-91
Gene SymbolTAF4
Gene Full NameTAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa
Alias SymbolsTAF2C, TAF4A, TAF2C1, TAFII130, TAFII135, TAFII-130, TAFII-135, TAF(II)130, TAF(II)135
NCBI Gene Id6874
Protein NameTranscription initiation factor TFIID subunit 4
Description of TargetInitiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF4 is one of the larger subunits of TFIID that has been shown to potentiate transcriptional activation by retinoic acid, thyroid hormone and vitamin D3 receptors. In addition, this subunit interacts with the transcription factor CREB, which has a glutamine-rich activation domain, and binds to other proteins containing glutamine-rich regions. Aberrant binding to this subunit by proteins with expanded polyglutamine regions has been suggested as one of the pathogenetic mechanisms underlying a group of neurodegenerative disorders referred to as polyglutamine diseases.Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the larger subunits of TFIID that has been shown to potentiate transcriptional activation by retinoic acid, thyroid hormone and vitamin D3 receptors. In addition, this subunit interacts with the transcription factor CREB, which has a glutamine-rich activation domain, and binds to other proteins containing glutamine-rich regions. Aberrant binding to this subunit by proteins with expanded polyglutamine regions has been suggested as one of the pathogenetic mechanisms underlying a group of neurodegenerative disorders referred to as polyglutamine diseases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDO00268
Protein Accession #NP_003176
Nucleotide Accession #NM_003185
Protein Size (# AA)1085
Molecular Weight110kDa
Protein InteractionsSOX6; SUMO2; UBC; FBXO6; MED26; HIST3H3; TBP; GTF2F2; JUN; SP1; HTT; AHR; TAF9B; TRRAP; TAF13; TAF1L; TAF3; TAF10; TAF9; TAF7; TAF6; TAF1; TAF12; ELAVL1; TAF8; ATF7; TCF12; CREB1; TBPL1; GTF2A1; TAF11; TAF5; TAF2; CBX5; CBX3; GTF2A2; CREM; SAP130; SUPT3H;
  1. What is the species homology for "TAF4 Antibody - middle region : FITC (ARP33394_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "TAF4 Antibody - middle region : FITC (ARP33394_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TAF4 Antibody - middle region : FITC (ARP33394_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TAF4 Antibody - middle region : FITC (ARP33394_P050-FITC)"?

    This target may also be called "TAF2C, TAF4A, TAF2C1, TAFII130, TAFII135, TAFII-130, TAFII-135, TAF(II)130, TAF(II)135" in publications.

  5. What is the shipping cost for "TAF4 Antibody - middle region : FITC (ARP33394_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TAF4 Antibody - middle region : FITC (ARP33394_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TAF4 Antibody - middle region : FITC (ARP33394_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "110kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TAF4 Antibody - middle region : FITC (ARP33394_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TAF4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TAF4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TAF4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TAF4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TAF4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TAF4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TAF4 Antibody - middle region : FITC (ARP33394_P050-FITC)
Your Rating
We found other products you might like!