Search Antibody, Protein, and ELISA Kit Solutions

TAF2 Antibody - middle region (ARP33392_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP33392_P050-FITC Conjugated

ARP33392_P050-HRP Conjugated

ARP33392_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, CHIP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-154048 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human TAF2
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Complete computational species homology data:
Anti-TAF2 (ARP33392_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKH
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TAF2 (ARP33392_P050) antibody is Catalog # AAP33392 (Previous Catalog # AAPP04438)
Datasheets/Manuals:
Printable datasheet for anti-TAF2 (ARP33392_P050) antibody
Sample Type Confirmation:

TAF2 is supported by BioGPS gene expression data to be expressed in HEK293T

Subunit:
2
Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648
Gene Symbol:
TAF2
Official Gene Full Name:
TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 150kDa
Alias Symbols:
CIF150, TAF2B, TAFII150
NCBI Gene Id:
6873
Protein Name:
Transcription initiation factor TFIID subunit 2
Description of Target:
Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF2 is one of the larger subunits of TFIID that is stably associated with the TFIID complex. It contributes to interactions at and downstream of the transcription initiation site, interactions that help determine transcription complex response to activators.Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the larger subunits of TFIID that is stably associated with the TFIID complex. It contributes to interactions at and downstream of the transcription initiation site, interactions that help determine transcription complex response to activators. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id:
Q6P1X5
Protein Accession #:
NP_003175
Nucleotide Accession #:
NM_003184
Protein Size (# AA):
1199
Molecular Weight:
137kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TAF2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TAF2.
Protein Interactions:
SHFM1; SOX2; SIRT1; RNPS1; MED26; HIST3H3; TAF9; TAF6; TAF1; ISG15; ESR1; TAF10; ELAVL1; UBC; TAF8; TERF2; TERF1; TBP; KDM5B; TAF13; TAF12; TAF11; TAF5; TAF4; TAF7;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...