TAF1A Antibody - C-terminal region : Biotin (P100802_P050-Biotin)

Catalog No: P100802_P050-Biotin

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TAF1A
• Predicted Homology Based on Immunogen Sequence: Cow: 78%; Dog: 85%; Horse: 85%; Human: 100%; Mouse: 85%; Pig: 85%; Rabbit: 85%; Rat: 85%
• Peptide Sequence: Synthetic peptide located within the following region: CEKAFVAGLLLGKGCRYFRYILKQDHQILGKKIKRMKRSVKKYSIVNPRL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TAF1A (P100802_P050-Biotin) antibody is Catalog # AAP31144 (Previous Catalog # AAPP01883)
• Subunit: A
• Reference: Di et al., (2000) Cytogenet. Cell Genet. 89 (1-2), 133-136

Target Info

• Gene Symbol: TAF1A
• Gene Full Name: TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa
• Alias Symbols: SL1, RAFI48, TAFI48, MGC:17061
• NCBI Gene Id: 9015
• Protein Name: TATA box-binding protein-associated factor RNA polymerase I subunit A
• Description of Target: Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. TAF1A encodes the smallest SL1-specific TAF.
• Uniprot ID: Q9NWA1
• Protein Accession #: NP_647603
• Nucleotide Accession #: NM_139352
• Protein Size (# AA): 336
• Molecular Weight: 40kDa
• Protein Interactions: C11orf57; JMJD6; TBP; Taf1c; Taf1b; BKRF1; UBC; TAF12; TAF1D; HIST1H4A; HIST1H3A; HIST2H2BE; HIST2H2AC; ESR1; SET; TAF1A; RUNX2; TP53; CD3EAP; HIST4H4; HIST3H3; ANP32A; UBTF; RRN3; MYC;