Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
P100965_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

P100965_P050-FITC Conjugated

P100965_P050-HRP Conjugated

P100965_P050-Biotin Conjugated

TAF12 Antibody - N-terminal region (P100965_P050)

Catalog#: P100965_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, CHIP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-103891 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TAF12
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 100%; Rat: 92%
Complete computational species homology data Anti-TAF12 (P100965_P050)
Peptide Sequence Synthetic peptide located within the following region: MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-TAF12 (P100965_P050) antibody is Catalog # AAP31326 (Previous Catalog # AAPP02076)
Datasheets/Manuals Printable datasheet for anti-TAF12 (P100965_P050) antibody
Sample Type Confirmation

TAF12 is supported by BioGPS gene expression data to be expressed in HEK293T

Subunit 12
Target Reference Denissov,S., (2007) EMBO J. 26 (4), 944-954
Gene Symbol TAF12
Official Gene Full Name TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa
Alias Symbols TAF2J, TAFII20
NCBI Gene Id 6883
Protein Name Transcription initiation factor TFIID subunit 12
Description of Target Control of transcription by RNA polymerase II involves the basal transcription machinery which is a collection of proteins. These proteins with RNA polymerase II, assemble into complexes which are modulated by transactivator proteins that bind to cis-regulatory elements located adjacent to the transcription start site. Some modulators interact directly with the basal complex, whereas others may act as bridging proteins linking transactivators to the basal transcription factors. Some of these associated factors are weakly attached while others are tightly associated with TBP in the TFIID complex. Among the latter are the TAF proteins. Different TAFs are predicted to mediate the function of distinct transcriptional activators for a variety of gene promoters and RNA polymerases. TAF12 interacts directly with TBP as well as with TAF2I.Control of transcription by RNA polymerase II involves the basal transcription machinery which is a collection of proteins. These proteins with RNA polymerase II, assemble into complexes which are modulated by transactivator proteins that bind to cis-regulatory elements located adjacent to the transcription start site. Some modulators interact directly with the basal complex, whereas others may act as bridging proteins linking transactivators to the basal transcription factors. Some of these associated factors are weakly attached while others are tightly associated with TBP in the TFIID complex. Among the latter are the TAF proteins. Different TAFs are predicted to mediate the function of distinct transcriptional activators for a variety of gene promoters and RNA polymerases. TAF12 interacts directly with TBP as well as with TAF2I. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id Q16514
Protein Accession # NP_005635
Nucleotide Accession # NM_005644
Protein Size (# AA) 161
Molecular Weight 18kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TAF12.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TAF12.
Protein Interactions PRKAR2B; SUMO1; UBE2I; TAF4B; KAT2B; HIST3H3; SUPT3H; TAF4; ERCC1; TAF10; ELAVL1; CPSF1; TAF3; TBP; TAF1A; TAF1C; ATF7; ATXN7; NFYC; NFYB; NFYA; TAF6; TAF8; TAF9; TAF11; TAF5; TAF15; TAF7; TAF2; TAF1; MYC;
  1. What is the species homology for "TAF12 Antibody - N-terminal region (P100965_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "TAF12 Antibody - N-terminal region (P100965_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TAF12 Antibody - N-terminal region (P100965_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TAF12 Antibody - N-terminal region (P100965_P050)"?

    This target may also be called "TAF2J, TAFII20" in publications.

  5. What is the shipping cost for "TAF12 Antibody - N-terminal region (P100965_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TAF12 Antibody - N-terminal region (P100965_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TAF12 Antibody - N-terminal region (P100965_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "18kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TAF12 Antibody - N-terminal region (P100965_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "TAF12"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TAF12"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TAF12"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TAF12"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TAF12"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TAF12"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TAF12 Antibody - N-terminal region (P100965_P050)
Your Rating
We found other products you might like!