Search Antibody, Protein, and ELISA Kit Solutions

TADA2L Antibody - N-terminal region (ARP38044_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38044_P050-FITC Conjugated

ARP38044_P050-HRP Conjugated

ARP38044_P050-Biotin Conjugated

Gene Symbol:
TADA2A
Official Gene Full Name:
Transcriptional adaptor 2A
NCBI Gene Id:
6871
Protein Name:
Transcriptional adapter 2-alpha
Swissprot Id:
Q9BVJ0
Protein Accession #:
NP_597683
Nucleotide Accession #:
NM_133439
Alias Symbols:
ADA2, FLJ12705, KL04P, hADA2, ADA2A, TADA2L
Replacement Item:
This antibody may replace item sc-244254 from Santa Cruz Biotechnology.
Description of Target:
Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter. TADA2L is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex.Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. Two transcript variants encoding different isoforms have been identified for this gene.
Protein Size (# AA):
305
Molecular Weight:
36kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TADA2L.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TADA2L.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human TADA2L
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-TADA2L (ARP38044_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MDRLGPFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MFAP1; MAGOH; KPNA2; FBF1; PRPF31; PPP1R16B; ZFYVE26; SF3A3; FARS2; MTX2; EIF4E2; FAM127C; KLHL38; TTC9C; ZNF564; TEKT4; LOC149950; KLC4; TTC23; GPSM3; CDCA7L; C1orf109; CCHCR1; PRKAB2; ARNT2; USP22; TADA3; HNF4A; LYN; HSP90AA1; KAT2B; MCPH1; PAXIP1; SUPT
Blocking Peptide:
For anti-TADA2A (ARP38044_P050) antibody is Catalog # AAP38044 (Previous Catalog # AAPP20219)
Datasheets/Manuals:
Printable datasheet for anti-TADA2A (ARP38044_P050) antibody
Sample Type Confirmation:

TADA2A is strongly supported by BioGPS gene expression data to be expressed in 721_B, Jurkat

Target Reference:
Yang,M., (2008) Cancer Biol. Ther. 7 (1), 120-128

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...