Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP87820_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

TACC2 Antibody - middle region (ARP87820_P050)

Catalog#: ARP87820_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human TACC2
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: KSPKRSPLSDPPSQDPTPAATPETPPVISAVVHATDEEKLAVTNQKWTCM
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-TACC2 (ARP87820_P050) antibody is Catalog # AAP87820
Datasheets/ManualsPrintable datasheet for anti-TACC2 (ARP87820_P050) antibody
Gene SymbolTACC2
Official Gene Full Nametransforming acidic coiled-coil containing protein 2
Alias SymbolsAZU-1, ECTACC
NCBI Gene Id10579
Protein Nametransforming acidic coiled-coil-containing protein 2
Description of TargetTransforming acidic coiled-coil proteins are a conserved family of centrosome- and microtubule-interacting proteins that are implicated in cancer. This gene encodes a protein that concentrates at centrosomes throughout the cell cycle. This gene lies within a chromosomal region associated with tumorigenesis. Expression of this gene is induced by erythropoietin and is thought to affect the progression of breast tumors. Several transcript variants encoding different isoforms have been found for this gene.
Swissprot IdO95359-2
Protein Accession #NP_001278807.1
Nucleotide Accession #NM_001291878.1
Protein Size (# AA)571
Molecular Weight62 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express TACC2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express TACC2.
Write Your Own Review
You're reviewing:TACC2 Antibody - middle region (ARP87820_P050)
Your Rating
Free Microscope
Aviva Blast Tool
Aviva HIS tag Deal
Assay Development