TACC2 Antibody - middle region (ARP87820_P050)

Catalog No: ARP87820_P050

Host: Rabbit
Target Name: TACC2
Sample Tissue: Human 786-0 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TACC2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: KSPKRSPLSDPPSQDPTPAATPETPPVISAVVHATDEEKLAVTNQKWTCM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TACC2 (ARP87820_P050) antibody is Catalog # AAP87820

Target Info

• Gene Symbol: TACC2
• Gene Full Name: transforming acidic coiled-coil containing protein 2
• Alias Symbols: AZU-1, ECTACC
• NCBI Gene Id: 10579
• Protein Name: transforming acidic coiled-coil-containing protein 2
• Description of Target: Transforming acidic coiled-coil proteins are a conserved family of centrosome- and microtubule-interacting proteins that are implicated in cancer. This gene encodes a protein that concentrates at centrosomes throughout the cell cycle. This gene lies within a chromosomal region associated with tumorigenesis. Expression of this gene is induced by erythropoietin and is thought to affect the progression of breast tumors. Several transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: O95359-2
• Protein Accession #: NP_001278807.1
• Nucleotide Accession #: NM_001291878.1
• Protein Size (# AA): 571
• Molecular Weight: 62 kDa