SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP84321_P050
Price: $0.00
SKU
ARP84321_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TAB1 (ARP84321_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TAB1
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: DDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVF
Concentration0.5 mg/ml
Blocking PeptideFor anti-TAB1 (ARP84321_P050) antibody is Catalog # AAP84321
Gene SymbolTAB1
Gene Full NameTGF-beta activated kinase 1/MAP3K7 binding protein 1
Alias Symbols3'-Tab1, MAP3K7IP1
NCBI Gene Id10454
Protein NameTGF-beta-activated kinase 1 and MAP3K7-binding protein 1
Description of TargetThe protein encoded by this gene was identified as a regulator of the MAP kinase kinase kinase MAP3K7/TAK1, which is known to mediate various intracellular signaling pathways, such as those induced by TGF beta, interleukin 1, and WNT-1. This protein interacts and thus activates TAK1 kinase. It has been shown that the C-terminal portion of this protein is sufficient for binding and activation of TAK1, while a portion of the N-terminus acts as a dominant-negative inhibitor of TGF beta, suggesting that this protein may function as a mediator between TGF beta receptors and TAK1. This protein can also interact with and activate the mitogen-activated protein kinase 14 (MAPK14/p38alpha), and thus represents an alternative activation pathway, in addition to the MAPKK pathways, which contributes to the biological responses of MAPK14 to various stimuli. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Uniprot IDQ15750
Protein Accession #NP_006107.1
Nucleotide Accession #NM_006116.2
Protein Size (# AA)504
Molecular Weight55 kDa
  1. What is the species homology for "TAB1 Antibody - N-terminal region (ARP84321_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "TAB1 Antibody - N-terminal region (ARP84321_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "TAB1 Antibody - N-terminal region (ARP84321_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TAB1 Antibody - N-terminal region (ARP84321_P050)"?

    This target may also be called "3'-Tab1, MAP3K7IP1" in publications.

  5. What is the shipping cost for "TAB1 Antibody - N-terminal region (ARP84321_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TAB1 Antibody - N-terminal region (ARP84321_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TAB1 Antibody - N-terminal region (ARP84321_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "55 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TAB1 Antibody - N-terminal region (ARP84321_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TAB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TAB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TAB1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TAB1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TAB1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TAB1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TAB1 Antibody - N-terminal region (ARP84321_P050)
Your Rating
We found other products you might like!