Search Antibody, Protein, and ELISA Kit Solutions

TAAR5 antibody - C-terminal region (ARP59626_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP59626_P050-FITC Conjugated

ARP59626_P050-HRP Conjugated

ARP59626_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Trace amine associated receptor 5
Protein Name:
Trace amine-associated receptor 5
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MGC138414, MGC138416, PNR, RP11-295F4.5
Replacement Item:
This antibody may replace item sc-50277 from Santa Cruz Biotechnology.
Description of Target:
TAAR5 is an orphan receptor. Ligands are likely small molecules, either sharing some similarities with trace amine as, e.g. derivatives of indolamines (such as 5-methoxytryptamine) or of phenylethylamines (such as phenylethanolamine) or being any kind of metabolite of amino acids or biogenic amine neurotransmitters.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TAAR5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TAAR5.
The immunogen is a synthetic peptide directed towards the C terminal region of human TAAR5
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 91%; Rabbit: 91%; Rat: 100%
Complete computational species homology data:
Anti-TAAR5 (ARP59626_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TTLSKSLAGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TAAR5 (ARP59626_P050) antibody is Catalog # AAP59626 (Previous Catalog # AAPP45735)
Printable datasheet for anti-TAAR5 (ARP59626_P050) antibody
Sample Type Confirmation:

TAAR5 is supported by BioGPS gene expression data to be expressed in PANC1

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...