Catalog No: OOSA09704 (Formerly GWB-F35315)
Size:100UG
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for SYNTHETIC Human ACTH Antigen (OOSA09704) |
|---|
| Predicted Species Reactivity | Human |
|---|---|
| Product Format | Liquid. Trifluoroacetate salt |
| Application | Enzyme-linked immunosorbent assay |
| Additional Information | Approx Protein Conc: Total protein concentration 1.0mg/ml Buffer solution: Trifluoroacetate salt |
| :: | Label Protein Molar Ratio: Solid phase synthesis Preservative: None present |
| Reconstitution and Storage | -20°C |
| Concentration | 1 mg/ml |
| Purity | HPLC: 98% |
| Predicted Homology Based on Immunogen Sequence | Human |
| Peptide Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Gene Symbol | POMC |
|---|---|
| Alias Symbols | LPH, MSH, NPP, POC, ACTH, CLIP, OBAIRH |
| NCBI Gene Id | 5443 |
| Protein Name | Pro-opiomelanocortin |
| Description of Target | SYNTHETIC HUMAN ACTH (aa1-39) |
| Uniprot ID | P01189 |
| Protein Accession # | NP_000930.1 |
| Protein Size (# AA) | Synthetic |
| Molecular Weight | 4541 Da |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!
