Search Antibody, Protein, and ELISA Kit Solutions

SYNTHETIC Human ACTH Antigen (OOSA09704)

0.1 mg
$169.00
In Stock
Request Bulk Order Quote

Gene Symbol:
POMC
Alias Symbols:
LPH, MSH, NPP, POC, ACTH, CLIP, POMC
NCBI Gene Id:
5443
Description of Target:
SYNTHETIC HUMAN ACTH (aa1-39)
Swissprot Id:
P01189
Protein Accession #:
NP_000930.1
Protein Name:
Pro-opiomelanocortin
Protein Size (# AA):
267
Molecular Weight:
4541 Da
Product Format:
Purified synthetic ACTH - liquid
Purity:
HPLC: 98%
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express POMC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express POMC.
Predicted Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human
Peptide Sequence:
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Additional Information:
Approx Protein Conc: Total protein concentration 1.0mg/ml
Buffer solution: Trifluoroacetate salt
:::
Label Protein Molar Ratio: Solid phase synthesis
Preservative: None present
Reconstitution and Storage:
Store at -20oC only.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the protein. Should this product contain a precipitate we recommend microcentrifugation before use.
Datasheets/Manuals:
Printable datasheet for OOSA09704

Product Reviews

Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...