Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP64403_P050
Price: $0.00
SKU
ARP64403_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

SYNGAP1 Antibody - C-terminal region (ARP64403_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-SYNGAP1 (ARP64403_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: EYKLKEYSKSMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-SYNGAP1 (ARP64403_P050) antibody is Catalog # AAP64403
Gene SymbolSYNGAP1
Gene Full NameSynaptic Ras GTPase activating protein 1
Alias SymbolsMRD5, RASA1, RASA5, SYNGAP
NCBI Gene Id8831
Protein NameRas GTPase-activating protein SynGAP
Description of TargetThe protein encoded by this gene is a major component of the postsynaptic density (PSD), a group of proteins found associated with NMDA receptors at synapses. The encoded protein is phosphorylated by calmodulin-dependent protein kinase II and dephosphorylated by NMDA receptor activation. Defects in this gene are a cause of mental retardation autosomal dominant type 5 (MRD5).
Uniprot IDQ96PV0
Protein Accession #NP_006763
Nucleotide Accession #NM_006772
Protein Size (# AA)1343
Molecular Weight148kDa
Protein InteractionsSAAL1; DLGAP4; GRIN1; ULK1; ULK2; MPDZ; CAMK2A; TRIP6; DLG4; GRIN2D; DLG3; KDR; PDGFRB; GRIN2B;
  1. What is the species homology for "SYNGAP1 Antibody - C-terminal region (ARP64403_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "SYNGAP1 Antibody - C-terminal region (ARP64403_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SYNGAP1 Antibody - C-terminal region (ARP64403_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SYNGAP1 Antibody - C-terminal region (ARP64403_P050)"?

    This target may also be called "MRD5, RASA1, RASA5, SYNGAP" in publications.

  5. What is the shipping cost for "SYNGAP1 Antibody - C-terminal region (ARP64403_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SYNGAP1 Antibody - C-terminal region (ARP64403_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SYNGAP1 Antibody - C-terminal region (ARP64403_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "148kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SYNGAP1 Antibody - C-terminal region (ARP64403_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SYNGAP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SYNGAP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SYNGAP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SYNGAP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SYNGAP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SYNGAP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SYNGAP1 Antibody - C-terminal region (ARP64403_P050)
Your Rating
We found other products you might like!