Search Antibody, Protein, and ELISA Kit Solutions

SWAP70 Antibody - N-terminal region (ARP46214_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP46214_T100-FITC Conjugated

ARP46214_T100-HRP Conjugated

ARP46214_T100-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-10882 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human SWAP70
Purification:
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-SWAP70 (ARP46214_T100)
Peptide Sequence:
Synthetic peptide located within the following region: ALEEHFRDDDEGPVSNQGYMPYLNRFILEKVQDNFDKIEFNRMCWTLCVK
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SWAP70 (ARP46214_T100) antibody is Catalog # AAP46214 (Previous Catalog # AAPP27049)
Datasheets/Manuals:
Printable datasheet for anti-SWAP70 (ARP46214_T100) antibody
Target Reference:
Liu,J., (2007) J. Histochem. Cytochem. 55 (7), 701-708
Gene Symbol:
SWAP70
Official Gene Full Name:
SWAP switching B-cell complex 70kDa subunit
Alias Symbols:
FLJ39540, HSPC321, KIAA0640, SWAP-70
NCBI Gene Id:
23075
Protein Name:
Switch-associated protein 70
Description of Target:
Phosphatidylinositol 3,4,5-trisphosphate-dependent guanine nucleotide exchange factor (GEF) which, independently of RAS, transduces signals from tyrosine kinase receptors to RAC. SWAP70 also mediates signaling of membrane ruffling. It regulates the actin cytoskeleton as an effector or adapter protein in response to agonist stimulated phosphatidylinositol (3,4)-bisphosphate production and cell protrusion.
Swissprot Id:
Q9UH65
Protein Accession #:
NP_055870
Nucleotide Accession #:
NM_015055
Protein Size (# AA):
585
Molecular Weight:
69kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SWAP70.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SWAP70.
Protein Interactions:
ZBTB5; RAPGEF4; UBC; CORO1B; ASUN; OTUD6B; JMJD6; GANAB; PACSIN2; FAF1; PAICS; FARSB; ZRANB2; RANBP3; CUL1; SUPT5H; SET; PPP2R5C; PLOD2; OSBP; GART; XRCC6; CRMP1; ATP6V1B2; C18orf8; CELSR3; IGHG1; PARP1; NPM1; NCL;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...