Catalog No: OASE00279
Size:100ug
Price: $429.00
SKU
OASE00279
Availability: Discontinued
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for OASE00279
Product Info
Predicted Species ReactivityHuman, Mouse, Rat
Product FormatLiquid. PBS, pH 7.4 with 0.1% sodium azide and 50% glycerol.
ClonalityMonoclonal
CloneS319A-14
IsotypeIgG2A
HostMouse
ConjugationUnconjugated
ApplicationWB, IHC, ICC, IF
Reconstitution and StorageStore at -20°C for one year. Avoid freeze/thaw cycles.
ImmunogenFusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
PurificationProtein G Purified
Concentration1 mg/ml
SpecificityDetects ~120kDa. Does not cross-react with SUR2B.
DilutionWB (1:1000); optimal dilutions for assays should be determined by the user.
Reference1. Campbell J.D., Sansom M.S., Ashcroft F.M. (2003) EMBO Resp. 4(11): 1038-1042.
2. Nichols C.G. (2006) Nature. 440 (7083): 470-476.
DescriptionSulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell (2).
Gene SymbolSUR2A
Gene Full NameATP-binding cassette, sub-family C (CFTR/MRP), member 9
Alias SymbolsABCC9, Sulfonylurea receptor 2, CMD10, ABC37, ATP-binding cassette transporter sub-family C member 9, Sulfonylurea receptor 2A, isoform SUR2A
NCBI Gene Id20928
Uniprot IDP70170
Protein Accession #NP_001038185.1
  1. What is the species homology for "SUR2A Antibody (OASE00279)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat".

  2. How long will it take to receive "SUR2A Antibody (OASE00279)"?

    This item is available "Domestic: within 1-2 weeks delivery | International: 1-2 weeks".

  3. What buffer format is "SUR2A Antibody (OASE00279)" provided in?

    This item is provided in "Liquid. PBS, pH 7.4 with 0.1% sodium azide and 50% glycerol.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SUR2A Antibody (OASE00279)"?

    This target may also be called "ABCC9, Sulfonylurea receptor 2, CMD10, ABC37, ATP-binding cassette transporter sub-family C member 9, Sulfonylurea receptor 2A, isoform SUR2A" in publications.

  5. What is the shipping cost for "SUR2A Antibody (OASE00279)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SUR2A Antibody (OASE00279)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SUR2A Antibody (OASE00279)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SUR2A Antibody (OASE00279)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SUR2A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SUR2A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SUR2A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SUR2A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SUR2A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SUR2A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SUR2A Antibody (OASE00279)
Your Rating
We found other products you might like!