Search Antibody, Protein, and ELISA Kit Solutions

SUPT3H Antibody - N-terminal region (ARP30038_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP30038_T100-FITC Conjugated

ARP30038_T100-HRP Conjugated

ARP30038_T100-Biotin Conjugated

Gene Symbol:
SUPT3H
Official Gene Full Name:
Suppressor of Ty 3 homolog (S. cerevisiae)
NCBI Gene Id:
8464
Protein Name:
Transcription initiation protein SPT3 homolog
Swissprot Id:
O75486
Protein Accession #:
NP_003590
Nucleotide Accession #:
NM_003599
Alias Symbols:
SPT3, SPT3L
Replacement Item:
This antibody may replace item sc-101157 from Santa Cruz Biotechnology.
Description of Target:
SUPT3H is a component of the multiprotein SPT-ADA-GCN5 acetyltransferase (SAGA) complex that integrates proteins with transcription coactivator/adaptor functions (ADAs and GCN5), histone acetyltransferase activity (GCN5), and core promoter-selective functions (SPTs) involving interactions with the TATA-binding protein (TBP).
Protein Size (# AA):
317
Molecular Weight:
36kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SUPT3H.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SUPT3H.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human SUPT3H
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 93%
Complete computational species homology data:
Anti-SUPT3H (ARP30038_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDLLEDKLSGSNNANKRQKI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
KAT2B; TADA1; CCDC101; SAP130; TADA3; SUPT7L; TRRAP; TCF3; TADA2A; KAT2A; TADA2B; TAF12; SUMO2; PYGO2; MED16; MED13; MED12; MED17; TAF10; TAF9; MED1; MYC; TP53; ATXN7; USP22; ATXN7L3; TAF5L; SF3B3; TAF6L; DDB2; DDB1; TAF5; TAF4;
Blocking Peptide:
For anti-SUPT3H (ARP30038_T100) antibody is Catalog # AAP30038 (Previous Catalog # AAPH00214)
Datasheets/Manuals:
Printable datasheet for anti-SUPT3H (ARP30038_T100) antibody
Sample Type Confirmation:

SUPT3H is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Yu,J., et al., (1998) Genomics 53 (1), 90-96

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...