Size:100 ul
$229.00
In Stock
SKU
ARP30038_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP30038_T100-FITC Conjugated

ARP30038_T100-HRP Conjugated

ARP30038_T100-Biotin Conjugated

SUPT3H Antibody - N-terminal region (ARP30038_T100)

Catalog#: ARP30038_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-101157 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SUPT3H
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 93%
Complete computational species homology data Anti-SUPT3H (ARP30038_T100)
Peptide Sequence Synthetic peptide located within the following region: MRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDLLEDKLSGSNNANKRQKI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SUPT3H (ARP30038_T100) antibody is Catalog # AAP30038 (Previous Catalog # AAPH00214)
Datasheets/Manuals Printable datasheet for anti-SUPT3H (ARP30038_T100) antibody
Sample Type Confirmation

SUPT3H is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference Yu,J., et al., (1998) Genomics 53 (1), 90-96
Gene Symbol SUPT3H
Official Gene Full Name Suppressor of Ty 3 homolog (S. cerevisiae)
Alias Symbols SPT3, SPT3L
NCBI Gene Id 8464
Protein Name Transcription initiation protein SPT3 homolog
Description of Target SUPT3H is a component of the multiprotein SPT-ADA-GCN5 acetyltransferase (SAGA) complex that integrates proteins with transcription coactivator/adaptor functions (ADAs and GCN5), histone acetyltransferase activity (GCN5), and core promoter-selective functions (SPTs) involving interactions with the TATA-binding protein (TBP).
Swissprot Id O75486
Protein Accession # NP_003590
Nucleotide Accession # NM_003599
Protein Size (# AA) 317
Molecular Weight 36kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SUPT3H.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SUPT3H.
Protein Interactions KAT2B; TADA1; CCDC101; SAP130; TADA3; SUPT7L; TRRAP; TCF3; TADA2A; KAT2A; TADA2B; TAF12; SUMO2; PYGO2; MED16; MED13; MED12; MED17; TAF10; TAF9; MED1; MYC; TP53; ATXN7; USP22; ATXN7L3; TAF5L; SF3B3; TAF6L; DDB2; DDB1; TAF5; TAF4;
  1. What is the species homology for "SUPT3H Antibody - N-terminal region (ARP30038_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "SUPT3H Antibody - N-terminal region (ARP30038_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SUPT3H Antibody - N-terminal region (ARP30038_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SUPT3H Antibody - N-terminal region (ARP30038_T100)"?

    This target may also be called "SPT3, SPT3L" in publications.

  5. What is the shipping cost for "SUPT3H Antibody - N-terminal region (ARP30038_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SUPT3H Antibody - N-terminal region (ARP30038_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SUPT3H Antibody - N-terminal region (ARP30038_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "36kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SUPT3H Antibody - N-terminal region (ARP30038_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SUPT3H"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SUPT3H"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SUPT3H"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SUPT3H"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SUPT3H"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SUPT3H"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SUPT3H Antibody - N-terminal region (ARP30038_T100)
Your Rating