SUN2 Antibody - N-terminal region : HRP (ARP75499_P050-HRP)

Catalog No: ARP75499_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SUN2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: RSQRLTRYSQGDDDGSSSSGGSSVAGSQSTLFKDSPLRTLKRKSSNMKRL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SUN2 (ARP75499_P050-HRP) antibody is Catalog # AAP75499

Target Info

• Gene Symbol: SUN2
• Alias Symbols: UNC84B
• NCBI Gene Id: 25777
• Description of Target: SUN1 (MIM 607723) and SUN2 are inner nuclear membrane (INM) proteins that play a major role in nuclear-cytoplasmic connection by formation of a 'bridge' across the nuclear envelope, known as the LINC complex, via interaction with the conserved luminal KASH domain of nesprins (e.g., SYNE1; MIM 608441) located in the outer nuclear membrane (ONM). The LINC complex provides a direct connection between the nuclear lamina and the cytoskeleton, which contributes to nuclear positioning and cellular rigidity.
• Uniprot ID: Q9UH99
• Protein Accession #: XP_005261558
• Protein Size (# AA): 717
• Molecular Weight: 78kDa
• Protein Interactions: FBXW11; NRM; BTRC; UBC; WHSC1; RPS20; RAB5B; RAB5A; TP53BP1; C9orf3; SYNE1; SYNE2; AGO3; USP20; HGS; RAB5C;