Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP30639_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP30639_P050-FITC Conjugated

ARP30639_P050-HRP Conjugated

ARP30639_P050-Biotin Conjugated

Sumo1 Antibody - N-terminal region (ARP30639_P050)

Catalog#: ARP30639_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-130275 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-Sumo1 (ARP30639_P050)
Peptide Sequence Synthetic peptide located within the following region: DQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYC
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Sumo1 (ARP30639_P050) antibody is Catalog # AAP30639 (Previous Catalog # AAPP01292)
Datasheets/Manuals Printable datasheet for anti-Sumo1 (ARP30639_P050) antibody
Gene Symbol Sumo1
Official Gene Full Name SMT3 suppressor of mif two 3 homolog 1 (yeast)
Alias Symbols GMP1, MGC103203, PIC1, SENTRIN, SMT3, SMT3H3, SMTP3, SUMO-1, Smt3C, Ubl1
NCBI Gene Id 22218
Protein Name Small ubiquitin-related modifier 1
Description of Target Ubiquitin-like protein that can be covalently attached to proteins as a monomer or a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by E3 ligases such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. It is involved for instance in targeting RANGAP1 to the nuclear pore complex protein RANBP2. Polymeric SUMO1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. It may also regulate a network of genes involved in palate development.
Swissprot Id P63166
Protein Accession # NP_033486
Nucleotide Accession # NM_009460
Protein Size (# AA) 101
Molecular Weight 11kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Sumo1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Sumo1.
Protein Interactions Pten; Stat1; Pml; Casp8ap2; Traf3; Pik3c3; Npm1; Mdm2; Ube2i; Trp53; Rangap1; Ranbp2; Mthfs; Sox2; Senp2; Rbbp7; Slc1a2; Uimc1; Nfatc2ip; Irf1; Irf8; Smad4; BCL11A; AXIN1; Myb; Pax6; Sept2; Daxx; Sf1; Sp3; Pou5f1; Hif1a; Nfkb2; Junb; Jun;
  1. What is the species homology for "Sumo1 Antibody - N-terminal region (ARP30639_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "Sumo1 Antibody - N-terminal region (ARP30639_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Sumo1 Antibody - N-terminal region (ARP30639_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Sumo1 Antibody - N-terminal region (ARP30639_P050)"?

    This target may also be called "GMP1, MGC103203, PIC1, SENTRIN, SMT3, SMT3H3, SMTP3, SUMO-1, Smt3C, Ubl1" in publications.

  5. What is the shipping cost for "Sumo1 Antibody - N-terminal region (ARP30639_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Sumo1 Antibody - N-terminal region (ARP30639_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Sumo1 Antibody - N-terminal region (ARP30639_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "11kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Sumo1 Antibody - N-terminal region (ARP30639_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SUMO1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SUMO1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SUMO1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SUMO1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SUMO1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SUMO1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Sumo1 Antibody - N-terminal region (ARP30639_P050)
Your Rating
We found other products you might like!