Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

SULT6B1 antibody - C-terminal region (ARP48531_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock

Conjugation Options

ARP48531_P050-FITC Conjugated

ARP48531_P050-HRP Conjugated

ARP48531_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
SULT6B1
NCBI Gene Id:
391365
Official Gene Full Name:
Sulfotransferase family, cytosolic, 6B, member 1
Protein Name:
Sulfotransferase 6B1
Swissprot Id:
Q6IMI4
Protein Accession #:
NP_001027549
Nucleotide Accession #:
NM_001032377
Alias Symbols:
-
Description of Target:
SULT6B1 belongs to the sulfotransferase 1 family. SULT6B1 may catalyze the sulfate conjugation of many drugs, xenobiotic compounds, hormones, and neurotransmitters.
Protein Size (# AA):
265
Molecular Weight:
30kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SULT6B1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SULT6B1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human SULT6B1
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 92%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 92%; Rat: 86%
Complete computational species homology data:
Anti-SULT6B1 (ARP48531_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FLGFFLTGEQIQTISVQSTFQAMRAKSQDTHGAVGPFLFRKGEVGDWKNL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SULT6B1 (ARP48531_P050) antibody is Catalog # AAP48531 (Previous Catalog # AAPY01475)
Datasheets/Manuals:
Printable datasheet for anti-SULT6B1 (ARP48531_P050) antibody
Target Reference:
Siebert,G., PLoS Biol. 5 (5), E97 (2007)

Tell us what you think about this item!

Write A Review
    Please, wait...