Search Antibody, Protein, and ELISA Kit Solutions

SULT4A1 Antibody - middle region (ARP73108_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73108_P050-FITC Conjugated

ARP73108_P050-HRP Conjugated

ARP73108_P050-Biotin Conjugated

Gene Symbol:
SULT4A1
NCBI Gene Id:
25830
Swissprot Id:
Q9BR01-2
Protein Accession #:
XP_005261572
Alias Symbols:
SULT4A1, SULTX3,
Replacement Item:
This antibody may replace item sc-129887 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the sulfotransferase family. The encoded protein is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. Polymorphisms in this gene may be associated with susceptibility to schizophrenia.
Protein Size (# AA):
260
Molecular Weight:
28kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SULT4A1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SULT4A1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human SULT4A1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Peptide Sequence:
Synthetic peptide located within the following region: ELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
POT1;
Blocking Peptide:
For anti-SULT4A1 (ARP73108_P050) antibody is Catalog # AAP73108
Datasheets/Manuals:
Printable datasheet for anti-SULT4A1 (ARP73108_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...