Search Antibody, Protein, and ELISA Kit Solutions

SULT2B1 Antibody - C-terminal region (ARP74853_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
SULT2B1
Official Gene Full Name:
sulfotransferase family 2B member 1
NCBI Gene Id:
6820
Protein Name:
Sulfotransferase family cytosolic 2B member 1
Swissprot Id:
O00204
Protein Accession #:
NP_004596.2
Nucleotide Accession #:
NM_004605.2
Alias Symbols:
HSST2, ARCI14
Description of Target:
Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene sulfates dehydroepiandrosterone but not 4-nitrophenol, a typical substrate for the phenol and estrogen sulfotransferase subfamilies. Two alternatively spliced variants that encode different isoforms have been described.
Protein Size (# AA):
365
Molecular Weight:
41 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SULT2B1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SULT2B1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human SULT2B1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: QMRGMPTFPWDEDPEEDGSPDPEPSPEPEPKPSLEPNTSLEREPRPNSSP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SULT2B1 (ARP74853_P050) antibody is Catalog # AAP74853
Datasheets/Manuals:
Printable datasheet for anti-SULT2B1 (ARP74853_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...