SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP73030_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP73030_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

SULT1C2 Antibody - N-terminal region : HRP (ARP73030_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-SULT1C2 (ARP73030_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human SULT1C2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: DLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWI
Concentration0.5 mg/ml
Blocking PeptideFor anti-SULT1C2 (ARP73030_P050-HRP) antibody is Catalog # AAP73030
Gene SymbolSULT1C2
Alias SymbolsST1C1, ST1C2, SULT1C1, humSULTC2
NCBI Gene Id6819
Description of TargetSULT1C2 is a sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Uniprot IDB4DLP0
Protein Accession #XP_005264069
Protein Size (# AA)310
Molecular Weight34kDa
Protein InteractionsRASGRP3; HLTF; ACD; TINF2; POT1; TERF1; UBC; SULT1C2;
  1. What is the species homology for "SULT1C2 Antibody - N-terminal region : HRP (ARP73030_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "SULT1C2 Antibody - N-terminal region : HRP (ARP73030_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SULT1C2 Antibody - N-terminal region : HRP (ARP73030_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SULT1C2 Antibody - N-terminal region : HRP (ARP73030_P050-HRP)"?

    This target may also be called "ST1C1, ST1C2, SULT1C1, humSULTC2" in publications.

  5. What is the shipping cost for "SULT1C2 Antibody - N-terminal region : HRP (ARP73030_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SULT1C2 Antibody - N-terminal region : HRP (ARP73030_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SULT1C2 Antibody - N-terminal region : HRP (ARP73030_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "34kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SULT1C2 Antibody - N-terminal region : HRP (ARP73030_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SULT1C2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SULT1C2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SULT1C2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SULT1C2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SULT1C2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SULT1C2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SULT1C2 Antibody - N-terminal region : HRP (ARP73030_P050-HRP)
Your Rating
We found other products you might like!