Search Antibody, Protein, and ELISA Kit Solutions

SULT1C2 Antibody - N-terminal region : FITC (ARP73030_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73030_P050 Unconjugated

ARP73030_P050-HRP Conjugated

ARP73030_P050-Biotin Conjugated

Gene Symbol:
SULT1C2
NCBI Gene Id:
6819
Swissprot Id:
B4DLP0
Protein Accession #:
XP_005264069
Replacement Item:
This antibody may replace item sc-130274 from Santa Cruz Biotechnology.
Description of Target:
SULT1C2 is a sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Protein Size (# AA):
310
Molecular Weight:
34kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SULT1C2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SULT1C2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SULT1C2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%
Peptide Sequence:
Synthetic peptide located within the following region: DLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
RASGRP3; HLTF; ACD; TINF2; POT1; TERF1; UBC; SULT1C2;
Blocking Peptide:
For anti-SULT1C2 (ARP73030_P050-FITC) antibody is Catalog # AAP73030
Datasheets/Manuals:
Printable datasheet for anti-SULT1C2 (ARP73030_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...