Search Antibody, Protein, and ELISA Kit Solutions

SULT1C2 Antibody - N-terminal region (ARP73030_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73030_P050-FITC Conjugated

ARP73030_P050-HRP Conjugated

ARP73030_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Protein Accession #:
Replacement Item:
This antibody may replace item sc-130274 from Santa Cruz Biotechnology.
Description of Target:
SULT1C2 is a sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SULT1C2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SULT1C2.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SULT1C2
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%
Peptide Sequence:
Synthetic peptide located within the following region: DLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWI
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SULT1C2 (ARP73030_P050) antibody is Catalog # AAP73030
Printable datasheet for anti-SULT1C2 (ARP73030_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...