SULT1C2 Antibody - C-terminal region (ARP49130_P050)

Catalog No: ARP49130_P050

WB Suggested Anti-SULT1C2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SULT1C2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: LDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SULT1C2 (ARP49130_P050) antibody is Catalog # AAP49130 (Previous Catalog # AAPY02326)
• Reference: Gerhard,D.S., PLoS Biol. 5 (5), E97 (2007)

Target Info

• Gene Symbol: SULT1C2
• Gene Full Name: Sulfotransferase family, cytosolic, 1C, member 2
• Alias Symbols: ST1C1, ST1C2, SULT1C1, humSULTC2
• NCBI Gene Id: 6819
• Protein Name: Sulfotransferase 1C2
• Description of Target: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. SULT1C2 is a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
• Uniprot ID: O00338
• Protein Accession #: NP_001047
• Nucleotide Accession #: NM_001056
• Protein Size (# AA): 296
• Molecular Weight: 35kDa
• Protein Interactions: RASGRP3; HLTF; ACD; TINF2; POT1; TERF1; UBC; SULT1C2;