SULT1A1 Recombinant Protein (Rat) (OPCA04642)

Catalog No: OPCA04642

Product Info

• Predicted Species Reactivity: Rat|Rattus norvegicus
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Rattus norvegicus (Rat)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRKGTTGDWKNTFTVAQNERFDAHYAKTMTDCDFKFRCEL
• Protein Sequence: MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRKGTTGDWKNTFTVAQNERFDAHYAKTMTDCDFKFRCEL
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-291 aa
• Tag: N-terminal 10XHis-SUMO-tagged and C-terminal Myc-tagged
• Reference: Nucleotide sequence of a full-length cDNA (PST-1) for aryl sulfotransferase from rat liver.Ozawa S., Nagata K., Gong D., Yamazoe Y., Kato R.Nucleic Acids Res. 18:4001-4001(1990)

Target Info

• Gene Symbol: Sult1a1
• Gene Full Name: sulfotransferase family 1A member 1
• Alias Symbols: Aryl sulfotransferase;Aryl sulfotransferase cytosolic, 1A, phenol-preferring, member 3;aryl sulfotransferase IV;ASTIV;minoxidil sulfotransferase;Mx-ST;Phenol sulfotransferase;Phenol sulfotransferase 1a1;PST-1;St1a1;Stm;Stp1;sulfokinase;sulfotransferase 1A1;sulfotransferase family 1A, phenol-preferring, member 1;sulfotransferase family, cytosolic, 1A, phenol preferring;sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1;sulphotransferase family cytosolic 1A phenol-prefering member 1;Sult1a3;tyrosine-ester sulfotransferase.
• NCBI Gene Id: 83783
• Protein Name: Sulfotransferase 1A1
• Description of Target: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Has also estrogen sulfotransferase activity. responsible for the sulfonation and activation of minoxidil. Is Mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk.
• Uniprot ID: P17988
• Protein Size (# AA): Recombinant
• Molecular Weight: 53.9 kDa