Search Antibody, Protein, and ELISA Kit Solutions

SULT1A1 Antibody - N-terminal region (ARP49134_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP49134_P050-FITC Conjugated

ARP49134_P050-HRP Conjugated

ARP49134_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, IHC
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
SULT1A1
Official Gene Full Name:
Sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1
NCBI Gene Id:
6817
Protein Name:
Sulfotransferase 1A2
Swissprot Id:
P50226
Protein Accession #:
NP_001046
Nucleotide Accession #:
NM_001055
Alias Symbols:
HAST1/HAST2, MGC131921, MGC5163, P-PST, PST, ST1A3, STP, STP1, TSPST1, ST1A1
Replacement Item:
This antibody may replace item sc-106578 from Santa Cruz Biotechnology.
Description of Target:
Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. SULT1A1 is one of two phenol sulfotransferases with thermostable enzyme activity. Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Multiple alternatively spliced variants that encode two isoforms have been identified for this gene.
Protein Size (# AA):
295
Molecular Weight:
34kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SULT1A1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SULT1A1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human SULT1A1
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 93%; Zebrafish: 86%
Complete computational species homology data:
Anti-SULT1A1 (ARP49134_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGT
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SULT2B1; TOM1L2; SRXN1; ZFYVE19; TUBB6; THADA; UBXN1; SMARCAL1; TMOD3; UBXN7; STMN2; AHCYL1; PTGES3; SSSCA1; YAP1; UBE4B; STUB1; UBA2; USP34; ZRANB2; ZPR1; STAM; UCHL3; SUMO1; UBE2B; UBE2A; TTC1; TRIP6; TPM4; TPM2; TPM1; SNCG; RCN1; PPM1G; ATP6V1B2; UBC;
Blocking Peptide:
For anti-SULT1A1 (ARP49134_P050) antibody is Catalog # AAP49134
Datasheets/Manuals:
Printable datasheet for anti-SULT1A1 (ARP49134_P050) antibody
Target Reference:
Suzuki,H., (er) Carcinogenesis (2008) In press
Publications:

Yalcin, E. B. et al. Downregulation of sulfotransferase expression and activity in diseased human livers. Drug Metab. Dispos. 41, 1642-50 (2013). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 23775849

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...