Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP49134_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP49134_P050-FITC Conjugated

ARP49134_P050-HRP Conjugated

ARP49134_P050-Biotin Conjugated

SULT1A1 Antibody - N-terminal region (ARP49134_P050)

Catalog#: ARP49134_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-106578 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SULT1A1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 93%; Zebrafish: 86%
Complete computational species homology data Anti-SULT1A1 (ARP49134_P050)
Peptide Sequence Synthetic peptide located within the following region: ELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGT
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SULT1A1 (ARP49134_P050) antibody is Catalog # AAP49134
Datasheets/Manuals Printable datasheet for anti-SULT1A1 (ARP49134_P050) antibody
Target Reference Suzuki,H., (er) Carcinogenesis (2008) In press
Publications

Yalcin, E. B. et al. Downregulation of sulfotransferase expression and activity in diseased human livers. Drug Metab. Dispos. 41, 1642-50 (2013). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 23775849

Gene Symbol SULT1A1
Official Gene Full Name Sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1
Alias Symbols HAST1/HAST2, MGC131921, MGC5163, P-PST, PST, ST1A3, STP, STP1, TSPST1, ST1A1
NCBI Gene Id 6817
Protein Name Sulfotransferase 1A2
Description of Target Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. SULT1A1 is one of two phenol sulfotransferases with thermostable enzyme activity. Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Multiple alternatively spliced variants that encode two isoforms have been identified for this gene.
Swissprot Id P50226
Protein Accession # NP_001046
Nucleotide Accession # NM_001055
Protein Size (# AA) 295
Molecular Weight 34kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SULT1A1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SULT1A1.
Protein Interactions SULT2B1; TOM1L2; SRXN1; ZFYVE19; TUBB6; THADA; UBXN1; SMARCAL1; TMOD3; UBXN7; STMN2; AHCYL1; PTGES3; SSSCA1; YAP1; UBE4B; STUB1; UBA2; USP34; ZRANB2; ZPR1; STAM; UCHL3; SUMO1; UBE2B; UBE2A; TTC1; TRIP6; TPM4; TPM2; TPM1; SNCG; RCN1; PPM1G; ATP6V1B2; UBC;
Write Your Own Review
You're reviewing:SULT1A1 Antibody - N-terminal region (ARP49134_P050)
Your Rating