SUCLG1 Antibody - middle region (ARP81994_P050)

Catalog No: ARP81994_P050

Host: Rabbit
Target Name: SUCLG1
Sample Tissue: Human HCT116 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SUCLG1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: NAEENAAEFLKQHNSGPNSKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SUCLG1 (ARP81994_P050) antibody is Catalog # AAP81994

Target Info

• Gene Symbol: SUCLG1
• Gene Full Name: succinate-CoA ligase, alpha subunit
• Alias Symbols: GALPHA, MTDPS9, SUCLA1
• NCBI Gene Id: 8802
• Protein Name: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
• Description of Target: This gene encodes the alpha subunit of the heterodimeric enzyme succinate coenzyme A ligase. This enzyme is targeted to the mitochondria and catalyzes the conversion of succinyl CoA and ADP or GDP to succinate and ATP or GTP. Mutations in this gene are the cause of the metabolic disorder fatal infantile lactic acidosis and mitochondrial DNA depletion.
• Uniprot ID: P53597
• Protein Accession #: NP_003840.2
• Nucleotide Accession #: NM_003849.3
• Protein Size (# AA): 346
• Molecular Weight: 36 kDa