STYXL1 Antibody - middle region (ARP60375_P050)

Catalog No: ARP60375_P050

WB Suggested Anti-STYXL1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human STYXL1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 93%; Rat: 79%
• Peptide Sequence: Synthetic peptide located within the following region: FLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-STYXL1 (ARP60375_P050) antibody is Catalog # AAP60375 (Previous Catalog # AAPP46554)

Target Info

• Gene Symbol: STYXL1
• Gene Full Name: Serine/threonine/tyrosine interacting-like 1
• Alias Symbols: DUSP24, MKSTYX, MK-STYX
• NCBI Gene Id: 51657
• Protein Name: Serine/threonine/tyrosine-interacting-like protein 1
• Description of Target: STYXL1 is a probable pseudophosphatase. It contains a Ser residue instead of a conserved Cys residue in the dsPTPase catalytic loop which probably renders it catalytically inactive as a phosphatase. The binding pocket may be however sufficiently preserved to bind phosphorylated substrates, and maybe protect them from phosphatases.
• Uniprot ID: Q9Y6J8
• Protein Accession #: NP_057170
• Nucleotide Accession #: NM_016086
• Protein Size (# AA): 313
• Molecular Weight: 36kDa
• Protein Interactions: UBC; TGFBR1; EHD4; ATXN10; SMC1A; RPS29; PSPH; AES; FLI1;