Search Antibody, Protein, and ELISA Kit Solutions

STYXL1 Antibody - middle region (ARP60375_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP60375_P050-FITC Conjugated

ARP60375_P050-HRP Conjugated

ARP60375_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-104230 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the middle region of human STYXL1
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 93%; Rat: 79%
Complete computational species homology data:
Anti-STYXL1 (ARP60375_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKA
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-STYXL1 (ARP60375_P050) antibody is Catalog # AAP60375 (Previous Catalog # AAPP46554)
Printable datasheet for anti-STYXL1 (ARP60375_P050) antibody
Gene Symbol:
Official Gene Full Name:
Serine/threonine/tyrosine interacting-like 1
Alias Symbols:
NCBI Gene Id:
Protein Name:
Serine/threonine/tyrosine-interacting-like protein 1
Description of Target:
STYXL1 is a probable pseudophosphatase. It contains a Ser residue instead of a conserved Cys residue in the dsPTPase catalytic loop which probably renders it catalytically inactive as a phosphatase. The binding pocket may be however sufficiently preserved to bind phosphorylated substrates, and maybe protect them from phosphatases.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express STYXL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express STYXL1.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...