Search Antibody, Protein, and ELISA Kit Solutions

STX1A Antibody - N-terminal region (ARP90001_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
STX1A
Official Gene Full Name:
syntaxin 1A (brain)
NCBI Gene Id:
20907
Protein Name:
syntaxin-1A
Swissprot Id:
O35526
Protein Accession #:
NP_058081.2
Nucleotide Accession #:
NM_016801.4
Alias Symbols:
HPC-1
Description of Target:
Plays a role in hormone and neurotransmitter exocytosis (By similarity). Potentially involved in docking of synaptic vesicles at presynaptic active zones. May mediate Ca2+-regulation of exocytosis acrosomal reaction in sperm (PubMed:15774481).
Protein Size (# AA):
288
Molecular Weight:
33 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express STX1A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express STX1A.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of mouse STX1A
Predicted Species Reactivity:
Mouse
Tested Species Reactivity:
Mouse
Peptide Sequence:
Synthetic peptide located within the following region: KDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-STX1A (ARP90001_P050) antibody is Catalog # AAP90001
Datasheets/Manuals:
Printable datasheet for anti-STX1A (ARP90001_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...