Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

STX1A Antibody - N-terminal region (ARP90001_P050)

Catalog#: ARP90001_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Mouse
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse STX1A
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: KDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-STX1A (ARP90001_P050) antibody is Catalog # AAP90001
Datasheets/Manuals Printable datasheet for anti-STX1A (ARP90001_P050) antibody
Gene Symbol STX1A
Official Gene Full Name syntaxin 1A (brain)
Alias Symbols HPC-1
NCBI Gene Id 20907
Protein Name syntaxin-1A
Description of Target Plays a role in hormone and neurotransmitter exocytosis (By similarity). Potentially involved in docking of synaptic vesicles at presynaptic active zones. May mediate Ca2+-regulation of exocytosis acrosomal reaction in sperm (PubMed:15774481).
Swissprot Id O35526
Protein Accession # NP_058081.2
Nucleotide Accession # NM_016801.4
Protein Size (# AA) 288
Molecular Weight 33 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express STX1A.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express STX1A.
  1. What is the species homology for "STX1A Antibody - N-terminal region (ARP90001_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Mouse".

  2. How long will it take to receive "STX1A Antibody - N-terminal region (ARP90001_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 business days".

  3. What buffer format is "STX1A Antibody - N-terminal region (ARP90001_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "STX1A Antibody - N-terminal region (ARP90001_P050)"?

    This target may also be called "HPC-1" in publications.

  5. What is the shipping cost for "STX1A Antibody - N-terminal region (ARP90001_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "STX1A Antibody - N-terminal region (ARP90001_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "STX1A Antibody - N-terminal region (ARP90001_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "33 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "STX1A Antibody - N-terminal region (ARP90001_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "STX1A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "STX1A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "STX1A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "STX1A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "STX1A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "STX1A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:STX1A Antibody - N-terminal region (ARP90001_P050)
Your Rating