STRAP Antibody - middle region (ARP88952_P050)

Catalog No: ARP88952_P050

Host: Rabbit
Target Name: STRAP
Sample Tissue: Mouse Lung lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse STRAP
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: KLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQTV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-STRAP (ARP88952_P050) antibody is Catalog # AAP88952

Target Info

• Gene Symbol: STRAP
• Gene Full Name: serine/threonine kinase receptor associated protein
• Alias Symbols: U, Unrip, C78091, C79202, AW557906
• NCBI Gene Id: 20901
• Protein Name: serine-threonine kinase receptor-associated protein
• Description of Target: The SMN complex plays a catalyst role in the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP. In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. Dissociation by the SMN complex of CLNS1A from the trapped Sm proteins and their transfer to an SMN-Sm complex triggers the assembly of core snRNPs and their transport to the nucleus. STRAP plays a role in the cellular distribution of the SMN complex. Negatively regulates TGF-beta signaling but positively regulates the PDPK1 kinase activity by enhancing its autophosphorylation and by significantly reducing the association of PDPK1 with 14-3-3 protein (By similarity).
• Uniprot ID: Q9Z1Z2
• Protein Accession #: NP_035629.2
• Nucleotide Accession #: NM_011499.3
• Protein Size (# AA): 350
• Molecular Weight: 38 kDa