STOML2 Antibody - middle region (ARP81661_P050)

Catalog No: ARP81661_P050

Host: Rabbit
Target Name: STOML2
Sample Tissue: Human 293T Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle terminal region of human STOML2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: LRIMDPYKASYGVEDPEYAVTQLAQTTMRSELGKLSLDKVFRERESLNAS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-STOML2 (ARP81661_P050) antibody is Catalog # AAP81661

Target Info

• Gene Symbol: STOML2
• Gene Full Name: stomatin like 2
• Alias Symbols: SLP-2, HSPC108
• NCBI Gene Id: 30968
• Protein Name: stomatin-like protein 2, mitochondrial
• Description of Target: Mitochondrial protein that probably regulates the biogenesis and the activity of mitochondria. Stimulates cardiolipin biosynthesis, binds cardiolipin-enriched membranes where it recruits and stabilizes some proteins including prohibitin and may therefore act in the organization of functional microdomains in mitochondrial membranes. Through regulation of the mitochondrial function may play a role into several biological processes including cell migration, cell proliferation, T-cell activation, calcium homeostasis and cellular response to stress. May play a role in calcium homeostasis through negative regulation of calcium efflux from mitochondria. Required for mitochondrial hyperfusion a pro-survival cellular response to stress which results in increased ATP production by mitochondria. May also regulate the organization of functional domains at the plasma membrane and play a role in T-cell activation through association with the T-cell receptor signaling complex and its regulation.
• Uniprot ID: Q9UJZ1
• Protein Accession #: NP_001273961.1
• Nucleotide Accession #: NM_001287031.1
• Protein Size (# AA): 356
• Molecular Weight: 39 kDa