Search Antibody, Protein, and ELISA Kit Solutions

STN1 Antibody - C-terminal region (ARP62578_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP62578_P050-FITC Conjugated

ARP62578_P050-HRP Conjugated

ARP62578_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
STN1
Official Gene Full Name:
STN1, CST complex subunit
NCBI Gene Id:
79991
Protein Name:
CST complex subunit STN1
Swissprot Id:
Q9H668
Protein Accession #:
NP_079204
Nucleotide Accession #:
NM_024928
Alias Symbols:
AAF44, OBFC1, AAF-44, RPA-32, bA541N10.2
Replacement Item:
This antibody may replace item sc-122212 from Santa Cruz Biotechnology.
Description of Target:
OBFC1 and C17ORF68 (MIM 613129) are subunits of an alpha accessory factor (AAF) that stimulates the activity of DNA polymerase-alpha-primase (see MIM 176636), the enzyme that initiates DNA replication (Casteel et al., 2009 [PubMed 19119139]). OBFC1 also appears to function in a telomere-associated complex with C17ORF68 and TEN1 (C17ORF106; MIM 613130) (Miyake et al., 2009 [PubMed 19854130]).[supplied by OMIM, Nov 2009]
Protein Size (# AA):
368
Molecular Weight:
40kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express STN1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express STN1.
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 86%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 79%
Complete computational species homology data:
Anti-OBFC1 (ARP62578_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DKDLHRKIHRIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQ
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
LDLRAP1; TPP1; MVP; APP; UBD; UBC; MED8; MED30; MED25; MED29; MED9; MED4; MED16; MED6; MED13; MED12; MED24; MED27; MED17; MED23; MED14; MED1; POLR2A; RCOR1; TUBGCP4;
Blocking Peptide:
For anti-STN1 (ARP62578_P050) antibody is Catalog # AAP62578
Datasheets/Manuals:
Printable datasheet for anti-STN1 (ARP62578_P050) antibody
Subunit:
STN1

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...