STK32B Antibody - middle region (ARP57238_P050)

Catalog No: ARP57238_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: STK32B
Sample Type: Lung Tumor lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human STK32B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 93%; Goat: 77%; Guinea Pig: 93%; Horse: 77%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Yeast: 86%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: LRYHLQQNVHFTEGTVKLYICELALALEYLQRYHIIHRDIKPDNILLDEH
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-STK32B (ARP57238_P050) antibody is Catalog # AAP57238

Target Info

• Gene Symbol: STK32B
• Gene Full Name: serine/threonine kinase 32B
• Alias Symbols: STK32, STKG6, YANK2, HSA250839
• NCBI Gene Id: 55351
• Protein Name: Serine/threonine-protein kinase 32B
• Description of Target: The function of this protein remains unknown.
• Uniprot ID: Q9NY57-2
• Protein Accession #: XP_006713956
• Protein Size (# AA): 367
• Molecular Weight: 40kDa
• Protein Interactions: HSP90AA1;