ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: ARP41743_T100
Price: $0.00
SKU
ARP41743_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-STK11 (ARP41743_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Horse, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human STK11
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE
Concentration1.0 mg/ml
Blocking PeptideFor anti-STK11 (ARP41743_T100) antibody is Catalog # AAP41743 (Previous Catalog # AAPP24386)
Sample Type Confirmation

STK11 is supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceXie,Z., (2006) J. Biol. Chem. 281 (10), 6366-6375
Gene SymbolSTK11
Gene Full NameSerine/threonine kinase 11
Alias SymbolsPJS, LKB1, hLKB1
NCBI Gene Id6794
Protein NameSerine/threonine-protein kinase STK11
Description of TargetSTK11is a member of the serine/threonine kinase family, regulates cell polarity and functions as a tumor suppressor. Mutations in its gene have been associated with Peutz-Jeghers syndrome, an autosomal dominant disorder characterized by the growth of polyps in the gastrointestinal tract, pigmented macules on the skin and mouth, and other neoplasms.This gene, which encodes a member of the serine/threonine kinase family, regulates cell polarity and functions as a tumor suppressor. Mutations in this gene have been associated with Peutz-Jeghers syndrome, an autosomal dominant disorder characterized by the growth of polyps in the gastrointestinal tract, pigmented macules on the skin and mouth, and other neoplasms. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.
Uniprot IDQ15831
Protein Accession #NP_000446
Nucleotide Accession #NM_000455
Protein Size (# AA)433
Molecular Weight48kDa
Protein InteractionsSPDEF; SIRT1; PRKAA1; ETV4; CDC37; HSP90AA1; TP63; Eif2b1; Ap2m1; SNRK; APP; TNIP2; SIK1; STRADA; STUB1; UBE2D2; MARK2; GSK3B; STRADB; CAB39; KIF23; USP11; SMARCC1; SMARCA4; LIMS1; HSPA1A; FKBP5; RPAP3; MARK4; UBC; CAB39L; WDR48; RPS6KB1; MOB4; MARK1; RPS
  1. What is the species homology for "STK11 Antibody - N-terminal region (ARP41743_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Horse, Zebrafish".

  2. How long will it take to receive "STK11 Antibody - N-terminal region (ARP41743_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "STK11 Antibody - N-terminal region (ARP41743_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "STK11 Antibody - N-terminal region (ARP41743_T100)"?

    This target may also be called "PJS, LKB1, hLKB1" in publications.

  5. What is the shipping cost for "STK11 Antibody - N-terminal region (ARP41743_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "STK11 Antibody - N-terminal region (ARP41743_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "STK11 Antibody - N-terminal region (ARP41743_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "48kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "STK11 Antibody - N-terminal region (ARP41743_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "STK11"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "STK11"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "STK11"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "STK11"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "STK11"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "STK11"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:STK11 Antibody - N-terminal region (ARP41743_T100)
Your Rating
We found other products you might like!