STIL Antibody - N-terminal region (ARP75124_P050)

Catalog No: ARP75124_P050

WB Suggested Anti-STIL antibody Titration: 1 ug/mL
Sample Type: Human THP-1 Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human STIL
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: QKLSSGKMPIHDHDSGVEDEDFSPRPIPSPHPVSQKISKIQPSVPELSLV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-STIL (ARP75124_P050) antibody is Catalog # AAP75124
• Reference: N/A

Target Info

• Gene Symbol: STIL
• Alias Symbols: SIL, MCPH7
• NCBI Gene Id: 6491
• Description of Target: This gene encodes a cytoplasmic protein implicated in regulation of the mitotic spindle checkpoint, a regulatory pathway that monitors chromosome segregation during cell division to ensure the proper distribution of chromosomes to daughter cells. The protein is phosphorylated in mitosis and in response to activation of the spindle checkpoint, and disappears when cells transition to G1 phase. It interacts with a mitotic regulator, and its expression is required to efficiently activate the spindle checkpoint. It is proposed to regulate Cdc2 kinase activity during spindle checkpoint arrest. Chromosomal deletions that fuse this gene and the adjacent locus commonly occur in T cell leukemias, and are thought to arise through illegitimate V-(D)-J recombination events. Multiple transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: Q15468
• Protein Size (# AA): 1287
• Molecular Weight: 141 kDa