STEFIN B Antibody (OABB02048)

Catalog No: OABB02048

Size:100UG

Click here to learn more about Aviva's By-Request Conjugation Service.

Anti-Stefin B Picoband antibody, OABB02048, Western blotting
All lanes: Anti Stefin B (OABB02048) at 0.5ug/ml
Lane 1: Human Placenta Tissue Lysate at 50ug
Lane 2: HELA Whole Cell Lysate at 40ug
Lane 3: A431 Whole Cell Lysate at 40ug
Lane 4: A549 Whole Cell Lysate at 40ug
Predicted bind size: 11KD
Observed bind size: 11KD

Anti-Stefin B Picoband antibody, OABB02048, IHC(P)
IHC(P): Human Prostatic Cancer Tissue

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Clonality: Polyclonal
• Clone: Polyclonal
• Isotype: Rabbit IgG
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Flow cytometry|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Western blot
• Additional Information: Notes: Tested Species: In-house tested species with positive results.
  By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
  Other applications have not been tested.
  Optimal dilutions should be determined by end users.
  Background: Cystatin B (CSTB), also called STFB, is a small protein that is a member of the superfamily of cysteine protease inhibitors. It has been isolated from human spleen and liver and its amino acid sequence has been fully determined. The cystatin B gene is located on 21q22.3. It is widely distributed and is localized mostly intracellularly, but has been found extracellularly. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. Its role is thought to be as a protector against the proteinases leaking from lysosomes. A cystatin B multiprotein complex might have a specific cerebellar function, and that the loss of this function might contribute to the etiopathogenesis of EPM1. Upon differentiation to myotubes, CSTB becomes excluded from the nucleus and lysosomes, suggesting that the subcellular distribution of CSTB is dependent on the differentiation status of the cell.
  
• Reconstitution and Storage: 2°C to 8°C|-20°C
• Immunogen: E. coli-derived human Stefin B recombinant protein (Position: M1-F98). Human Stefin B shares 78.6 % amino acid (aa) sequence identity with both mouse and rat Stefin B.
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
• Concentration: 500 ug/ml
• Specificity: No cross reactivity with other proteins.
• Application Info: Western blot: 0.1-0.5 ug/ml: Human
  Immunohistochemistry (Paraffin-embedded Section): 0.5-1 ug/ml: Human: By Heat
  Immunohistochemistry (Frozen Section): 0.5-1 ug/ml: Human
  Immunocytochemistry: 0.5-1 ug/ml: Human
  Flow Cytometry: 1-3 ug/1x10^6 cells: Human
  ELISA : 0.1-0.5 ug/ml: Human
• Reference: 1. Alakurtti, K., Weber, E., Rinne, R., Theil, G., de Haan, G.-J., Lindhout, D., Salmikangas, P., Saukko, P., Lahtinen, U., Lehesjoki, A.-E. Loss of lysosomal association of cystatin B proteins representing progressive myoclonus epilepsy, EPM1, mutations. Europ. J. Hum. Genet. 13: 208-215, 2005. Note: Erratum: Europ. J. Hum. Genet. 13: 264 only, 2005.
  2. Antonarakis, S. Personal Communication. Geneva, Switzerland 4/8/1997.
  3. Bespalova, I. N., Adkins, S., Pranzatelli, M., Burmeister, M. Novel cystatin B mutation and diagnostic PCR assay in an Unverricht-Lundborg progressive myoclonus epilepsy patient. Am. J. Med. Genet. 74: 467-471, 1997.
  
• Storage Buffer: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Description: Rabbit IgG polyclonal antibody for Cystatin-B(CSTB) detection. Tested with WB, IHC-P, IHC-F, ICC, FCM, ELISA in Human.

Target Info

• Gene Symbol: CSTB
• Gene Full Name: cystatin B
• Alias Symbols: CPI-B;CST6;cystatin B (stefin B);cystatin-B;epididymis secretory sperm binding protein;EPM1;EPM1A;liver thiol proteinase inhibitor;PME;Stefin-B;STFB;ULD.
• NCBI Gene Id: 1476
• Protein Name: Cystatin-B
• Description of Target: This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B.
• Uniprot ID: P04080
• Molecular Weight: 11140 MW