STC1 Antibody - N-terminal region (ARP42104_P050)

Catalog No: ARP42104_P050

WB Suggested Anti-STC1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysateThere is BioGPS gene expression data showing that STC1 is expressed in 721_B

Host: Rabbit
Target Name: STC1
Sample Tissue: Human A549 Whole Cell
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human STC1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MLQNSAVLLVLVISASATHEAEQNDSVSPRKSRVAAQNSAEVVRCLNSAL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-STC1 (ARP42104_P050) antibody is Catalog # AAP42104 (Previous Catalog # AAPP24583)
• Sample Type Confirmation:

  There is BioGPS gene expression data showing that STC1 is expressed in 721_B

• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Chen,C., (2008) Arterioscler. Thromb. Vasc. Biol. 28 (5), 906-912

Target Info

• Gene Symbol: STC1
• Gene Full Name: Stanniocalcin 1
• Alias Symbols: STC
• NCBI Gene Id: 6781
• Protein Name: Stanniocalcin-1
• Description of Target: STC1 is a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. It contains 11 conserved cysteine residues and is phosphorylated by protein kinase C exclusively on its serine residues. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Overexpression of human stanniocalcin 1 in mice produces high serum phosphate levels, dwarfism, and increased metabolic rate.This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The gene contains a 5' UTR rich in CAG trinucleotide repeats. The encoded protein contains 11 conserved cysteine residues and is phosphorylated by protein kinase C exclusively on its serine residues. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Overexpression of human stanniocalcin 1 in mice produces high serum phosphate levels, dwarfism, and increased metabolic rate. This gene has altered expression in hepatocellular, ovarian, and breast cancers. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P52823
• Protein Accession #: NP_003146
• Nucleotide Accession #: NM_003155
• Protein Size (# AA): 247
• Molecular Weight: 28 kDa