- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for STAT6 Antibody (Phospho-Tyr641) (OAAF07789) |
|---|
| Predicted Species Reactivity | Human|Mouse|Rat |
|---|---|
| Product Format | Liquid PBS (without Mg2+ and Ca2+) pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot |
| Additional Information | Modification Sites: Human:Y641 Mouse:Y641 Rat:Y641 |
| Reconstitution and Storage | -20°C |
| Immunogen | The antiserum was produced against synthesized peptide derived from human STAT6 around the phosphorylation site of Tyr641. |
| Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
| Peptide Sequence | Synthetic peptide located within the following region: DLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLP |
| Concentration | 1 mg/ml |
| Specificity | STAT6 (Phospho-Tyr641) Antibody detects endogenous levels of STAT6 only when phosphorylated at Tyr641. |
| Application Info | WB: 1:500~1000 IHC: 1:50~100 ELISA: 1:10000 |
| Gene Symbol | STAT6 |
|---|---|
| Gene Full Name | signal transducer and activator of transcription 6 |
| Alias Symbols | D12S1644;IL-4 Stat;IL-4-STAT;signal transducer and activator of transcription 6;signal transducer and activator of transcription 6, interleukin-4 induced;STAT, interleukin4-induced;STAT6B;STAT6C;transcription factor IL-4 STAT. |
| NCBI Gene Id | 6778 |
| Protein Name | Signal transducer and activator of transcription 6 |
| Description of Target | Carries out a dual function: signal transduction and activation of transcription. Involved in IL4/interleukin-4- and IL3/interleukin-3-mediated signaling. |
| Uniprot ID | P42226 |
| Molecular Weight | 94 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "STAT6 Antibody (Phospho-Tyr641) (OAAF07789)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "STAT6 Antibody (Phospho-Tyr641) (OAAF07789)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "STAT6 Antibody (Phospho-Tyr641) (OAAF07789)" provided in?
This item is provided in "Liquid PBS (without Mg2+ and Ca2+) pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "STAT6 Antibody (Phospho-Tyr641) (OAAF07789)"?
This target may also be called "D12S1644;IL-4 Stat;IL-4-STAT;signal transducer and activator of transcription 6;signal transducer and activator of transcription 6, interleukin-4 induced;STAT, interleukin4-induced;STAT6B;STAT6C;transcription factor IL-4 STAT." in publications.
-
What is the shipping cost for "STAT6 Antibody (Phospho-Tyr641) (OAAF07789)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "STAT6 Antibody (Phospho-Tyr641) (OAAF07789)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "STAT6 Antibody (Phospho-Tyr641) (OAAF07789)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "94 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "STAT6 Antibody (Phospho-Tyr641) (OAAF07789)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "STAT6"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "STAT6"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "STAT6"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "STAT6"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "STAT6"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "STAT6"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
