Search Antibody, Protein, and ELISA Kit Solutions

STAT6 Antibody - C-terminal region (ARP38257_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP38257_P050-FITC Conjugated

ARP38257_P050-HRP Conjugated

ARP38257_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-117401 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the C terminal region of human STAT6
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-STAT6 (ARP38257_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLRANPSW
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-STAT6 (ARP38257_P050) antibody is Catalog # AAP38257 (Previous Catalog # AAPP23111)
Printable datasheet for anti-STAT6 (ARP38257_P050) antibody
Target Reference:
Blanchard,C., (2005) Int. J. Biochem. Cell Biol. 37 (12), 2559-2573
Gene Symbol:
Official Gene Full Name:
Signal transducer and activator of transcription 6, interleukin-4 induced
Alias Symbols:
NCBI Gene Id:
Protein Name:
Signal transducer and activator of transcription 6
Description of Target:
STAT6 is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins.The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express STAT6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express STAT6.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...