Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

STAT6 antibody - C-terminal region (ARP31048_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP31048_P050-FITC Conjugated

ARP31048_P050-HRP Conjugated

ARP31048_P050-Biotin Conjugated

Gene Symbol:
STAT6
NCBI Gene Id:
6778
Official Gene Full Name:
Signal transducer and activator of transcription 6, interleukin-4 induced
Protein Name:
Signal transducer and activator of transcription 6
Swissprot Id:
P42226
Protein Accession #:
NP_003144
Nucleotide Accession #:
NM_003153
Alias Symbols:
D12S1644, IL-4-STAT, STAT6B, STAT6C
Replacement Item:
This antibody may replace item sc-117401 from Santa Cruz Biotechnology.
Description of Target:
Full-length human STAR6 (NP_003144) was expressed in E.coli as inclusion body and purified after protein refolding for mouse immunization. Clone 5B1 shows excellent western blot detection of endogenous STAT6 using ACHN cell lysate.The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
847
Molecular Weight:
94kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express STAT6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express STAT6.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human STAT6
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-STAT6 (ARP31048_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQM
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; IRF4; PDE12; EHD1; USP8; API5; PGGT1B; EP300; TRIM28; JAK3; RCN3; LITAF; IL4R; EEF1A1; VKORC1; PTPN2; STAT2; JAK1; IFNG; IFNAR1; SRXN1; PSAT1; DSTN; SEC24A; AHCYL1; SSSCA1; NUBP2; SH3BGRL; RAD23B; PPM1G; IGBP1; CEBPE; SND1; SUMO2; FCER2; SFPQ; IGHE;
Blocking Peptide:
For anti-STAT6 (ARP31048_P050) antibody is Catalog # AAP31048 (Previous Catalog # AAPP24027)
Datasheets/Manuals:
Printable datasheet for anti-STAT6 (ARP31048_P050) antibody
Sample Type Confirmation:

STAT6 is strongly supported by BioGPS gene expression data to be expressed in HeLa

Additional Information:
IHC Information: Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Prostate: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Testis: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Tonsil: Formalin-Fixed, Paraffin-Embedded (FFPE)
Target Reference:
Li,B.H., (2008) Biochem. Biophys. Res. Commun. 369 (2), 554-560

Tell us what you think about this item!

Write A Review
    Please, wait...