Size:100 ug
$299.00
In Stock
SKU
OAAF07784
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

OAAF07784-FITC Conjugated

OAAF07784-HRP Conjugated

OAAF07784-Biotin Conjugated

STAT3 Antibody (Phospho-Ser727) (OAAF07784)

Catalog#: OAAF07784
Domestic: within 1 week delivery | International: 1 week
This product is Genway GWB-ASB809
More Information
Predicted Species Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Additional Information Modification Sites: Human:S727 Mouse:S727 Rat:S727
Reconstitution and Storage Stable at -20C for at least 1 year.
Replacement Item This antibody may replace item sc-126054 from Santa Cruz Biotechnology.
Immunogen The antiserum was produced against synthesized peptide derived from human STAT3 around the phosphorylation site of Ser727.
Purification The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Peptide Sequence Synthetic peptide located within the following region: HPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEG
Concentration 1mg/ml
Datasheets/Manuals Printable datasheet for OAAF07784
Specificity STAT3 (Phospho-Ser727) Antibody detects endogenous levels of STAT3 only when phosphorylated at Ser727.
Formulation Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application Info WB: 1:500~1:1000
IHC: 1:50~1:100
ELISA: 1:10000
Gene Symbol STAT3
Alias Symbols Signal transducer and activator of transcription 3, Acute-phase response factor, STAT3, APRF
NCBI Gene Id 6774
Swissprot Id P40763
Molecular Weight 88 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express STAT3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express STAT3.
  1. What is the species homology for "STAT3 Antibody (Phospho-Ser727) (OAAF07784)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat".

  2. How long will it take to receive "STAT3 Antibody (Phospho-Ser727) (OAAF07784)"?

    This item is available "Domestic: within 1 week delivery | International: 1 week".

  3. What buffer format is "STAT3 Antibody (Phospho-Ser727) (OAAF07784)" provided in?

    This item is provided in "".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "STAT3 Antibody (Phospho-Ser727) (OAAF07784)"?

    This target may also be called "Signal transducer and activator of transcription 3, Acute-phase response factor, STAT3, APRF" in publications.

  5. What is the shipping cost for "STAT3 Antibody (Phospho-Ser727) (OAAF07784)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "STAT3 Antibody (Phospho-Ser727) (OAAF07784)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "STAT3 Antibody (Phospho-Ser727) (OAAF07784)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "88 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "STAT3 Antibody (Phospho-Ser727) (OAAF07784)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "STAT3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "STAT3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "STAT3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "STAT3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "STAT3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "STAT3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:STAT3 Antibody (Phospho-Ser727) (OAAF07784)
Your Rating
We found other products you might like!