Search Antibody, Protein, and ELISA Kit Solutions

STAT3 Antibody (Phospho-Ser727) (OAAF07784)

100 ug
$379.00
In Stock
Request Bulk Order Quote

Conjugation Options

OAAF07784-FITC Conjugated

OAAF07784-HRP Conjugated

OAAF07784-Biotin Conjugated

Gene Symbol:
STAT3
NCBI Gene Id:
6774
Swissprot Id:
P40763
Alias Symbols:
Signal transducer and activator of transcription 3, Acute-phase response factor, STAT3, APRF
Replacement Item:
This antibody may replace item sc-126054 from Santa Cruz Biotechnology.
Molecular Weight:
88 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Application:
WB, IHC, ELISA
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express STAT3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express STAT3.
Immunogen:
The antiserum was produced against synthesized peptide derived from human STAT3 around the phosphorylation site of Ser727.
Predicted Species Reactivity:
Human, Mouse, Rat
Peptide Sequence:
Synthetic peptide located within the following region: HPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEG
Reconstitution and Storage:
Stable at -20C for at least 1 year.
Concentration:
1mg/ml
Datasheets/Manuals:
Printable datasheet for OAAF07784
Specificity:
STAT3 (Phospho-Ser727) Antibody detects endogenous levels of STAT3 only when phosphorylated at Ser727.
Formulation:
Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application Info:
WB: 1:500~1:1000
IHC: 1:50~1:100
ELISA: 1:10000
Additional Information:
Modification Sites: Human:S727 Mouse:S727 Rat:S727

Product Reviews

Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...