Search Antibody, Protein, and ELISA Kit Solutions

STAT3 Antibody - N-terminal region (ARP38253_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38253_P050-FITC Conjugated

ARP38253_P050-HRP Conjugated

ARP38253_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Additional Information:
IHC Information: Kidney
IHC Information: Uterus
IHC Information: Prostate
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-126054 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human STAT3
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-STAT3 (ARP38253_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKES
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-STAT3 (ARP38253_P050) antibody is Catalog # AAP38253 (Previous Catalog # AAPP23107)
Printable datasheet for anti-STAT3 (ARP38253_P050) antibody
Other Applications Image 1 Data:
Immunofluorescence --
Sample Type: Macrophages
Dilution: 1:1000
Target Reference:
Ohbayashi,N., (2008) Biochem. Biophys. Res. Commun. 371 (4), 823-828

Deng, W. et al. Bone marrow mesenchymal stromal cells with support of bispecific antibody and ultrasound-mediated microbubbles prevent myocardial fibrosis via the signal transducer and activators of transcription signaling pathway. Cytotherapy 13, 431-40 (2011). IHC, WB, IF, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21174489

Deng, W; Chen, QW; Li, XS; Yuan, ZM; Li, GQ; Ke, DZ; Wang, L; Wu, ZQ; Luo, SL; Bone marrow mesenchymal stromal cells with CD47 high expression via the signal transducer and activators of transcription signaling pathway preventing myocardial fibrosis. 8, 10555-64 (2015). IHC, WB, IF, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26617765

Vega, V. L. et al. Activation of the stress response in macrophages alters the M1/M2 balance by enhancing bacterial killing and IL-10 expression. J. Mol. Med. (Berl). 92, 1305-17 (2014). IHC, WB, IF, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 25163764

Gene Symbol:
Official Gene Full Name:
Signal transducer and activator of transcription 3 (acute-phase response factor)
Alias Symbols:
APRF, FLJ20882, MGC16063, HIES
NCBI Gene Id:
Protein Name:
Signal transducer and activator of transcription 3 isoform 2 EMBL BAG70046.1
Description of Target:
STAT3 is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT3 is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. It mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein.The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. Three alternatively spliced transcript variants encoding distinct isoforms have been described.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express STAT3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express STAT3.
Protein Interactions:

Product Reviews

Average Rating:
1 review
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

289/10/2017 16:06
  • Quality:
  • Overall Experience:
Product Review: STAT3 antibody - N-terminal region (ARP38253_P050)

Great product

Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...