Search Antibody, Protein, and ELISA Kit Solutions

STAT1 Antibody - N-terminal region (ARP36979_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP36979_T100-FITC Conjugated

ARP36979_T100-HRP Conjugated

ARP36979_T100-Biotin Conjugated

Gene Symbol:
STAT1
Official Gene Full Name:
Signal transducer and activator of transcription 1
NCBI Gene Id:
20846
Protein Name:
Signal transducer and activator of transcription 1
Swissprot Id:
P42225
Protein Accession #:
NP_033309
Nucleotide Accession #:
NM_009283
Alias Symbols:
AA408197, 2010005J02Rik
Replacement Item:
This antibody may replace item sc-123815 from Santa Cruz Biotechnology.
Description of Target:
Stat1 is a member of the STAT family. It can form homodimers to modulate the transcriptional repression of PPARgamma2 in adipocytes
Protein Size (# AA):
749
Molecular Weight:
82kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express STAT1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express STAT1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of mouse STAT1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Tested Species Reactivity:
Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Guinea Pig: 85%; Horse: 86%; Human: 86%; Mouse: 100%; Pig: 86%; Rabbit: 93%; Rat: 100%; Sheep: 86%
Complete computational species homology data:
Anti-STAT1 (ARP36979_T100)
Peptide Sequence:
Synthetic peptide located within the following region: QLQSWFTIVAETLQQIRQQLKKLEELEQKFTYEPDPITKNKQVLSDRTFL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Isg15; Sumo1; Zfp467; Stat1; Fbxo2; Mapk1; Ubc; Btrc; Atf3; Pdlim2; Stat3; Mllt10; SMURF2; SMURF1; TGFBR1; SMAD4; ACVR1; Il6st; Gfap; S100b; Ifng; Tbx21;
Blocking Peptide:
For anti-STAT1 (ARP36979_T100) antibody is Catalog # AAP36979 (Previous Catalog # AAPP09175)
Datasheets/Manuals:
Printable datasheet for anti-STAT1 (ARP36979_T100) antibody
Target Reference:
Mikhak,Z., et al., (2006) J. Immunol. 176 (8), 4959-4967

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...