Search Antibody, Protein, and ELISA Kit Solutions

STAT1 Antibody - C-terminal region (ARP38934_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38934_P050-FITC Conjugated

ARP38934_P050-HRP Conjugated

ARP38934_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, IHC
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
STAT1
Official Gene Full Name:
Signal transducer and activator of transcription 1, 91kDa
NCBI Gene Id:
6772
Protein Name:
Signal transducer and activator of transcription 1-alpha/beta
Swissprot Id:
P42224
Protein Accession #:
NP_009330
Nucleotide Accession #:
NM_007315
Alias Symbols:
DKFZp686B04100, ISGF-3, STAT91, CANDF7
Replacement Item:
This antibody may replace item sc-123815 from Santa Cruz Biotechnology.
Description of Target:
STAT1 is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens.Western blots using four different antibodies against three unique regions of this protein target confirm the same apparent molecular weight in our tests.The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens. Two alternatively spliced transcript variants encoding distinct isoforms have been described.
Protein Size (# AA):
750
Molecular Weight:
87kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express STAT1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express STAT1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human STAT1
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 82%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-STAT1 (ARP38934_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DGPKGTGYIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEF
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HUWE1; ISG15; PIAS1; UBC; STAT1; EIF1AD; OTUD4; LMO2; GNB2; DTX3L; EGFR; NAA15; SNX6; CAND1; VPS29; GSPT2; JMJD6; RTF1; HSPA4L; ATG7; YAP1; PAWR; KARS; IDE; CTTN; VPS26A; HIRIP3; NAA10; TSNAX; TBCD; SNX2; SNX1; SHMT2; SHMT1; SARS; ATP6V1C1; APEH; USP13; E
Blocking Peptide:
For anti-STAT1 (ARP38934_P050) antibody is Catalog # AAP38934 (Previous Catalog # AAPP22966)
Datasheets/Manuals:
Printable datasheet for anti-STAT1 (ARP38934_P050) antibody
Target Reference:
Battle,T.E., (2006) Cancer Res. 66 (7), 3649-3657

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...