Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP38934_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP38934_P050-FITC Conjugated

ARP38934_P050-HRP Conjugated

ARP38934_P050-Biotin Conjugated

STAT1 Antibody - C-terminal region (ARP38934_P050)

Catalog#: ARP38934_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-123815 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human STAT1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 82%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Complete computational species homology data Anti-STAT1 (ARP38934_P050)
Peptide Sequence Synthetic peptide located within the following region: DGPKGTGYIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEF
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-STAT1 (ARP38934_P050) antibody is Catalog # AAP38934 (Previous Catalog # AAPP22966)
Datasheets/Manuals Printable datasheet for anti-STAT1 (ARP38934_P050) antibody
Target Reference Battle,T.E., (2006) Cancer Res. 66 (7), 3649-3657
Gene Symbol STAT1
Official Gene Full Name Signal transducer and activator of transcription 1, 91kDa
Alias Symbols DKFZp686B04100, ISGF-3, STAT91, CANDF7
NCBI Gene Id 6772
Protein Name Signal transducer and activator of transcription 1-alpha/beta
Description of Target STAT1 is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens.Western blots using four different antibodies against three unique regions of this protein target confirm the same apparent molecular weight in our tests.The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens. Two alternatively spliced transcript variants encoding distinct isoforms have been described.
Swissprot Id P42224
Protein Accession # NP_009330
Nucleotide Accession # NM_007315
Protein Size (# AA) 750
Molecular Weight 87kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express STAT1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express STAT1.
Protein Interactions HUWE1; ISG15; PIAS1; UBC; STAT1; EIF1AD; OTUD4; LMO2; GNB2; DTX3L; EGFR; NAA15; SNX6; CAND1; VPS29; GSPT2; JMJD6; RTF1; HSPA4L; ATG7; YAP1; PAWR; KARS; IDE; CTTN; VPS26A; HIRIP3; NAA10; TSNAX; TBCD; SNX2; SNX1; SHMT2; SHMT1; SARS; ATP6V1C1; APEH; USP13; E
  1. What is the species homology for "STAT1 Antibody - C-terminal region (ARP38934_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep".

  2. How long will it take to receive "STAT1 Antibody - C-terminal region (ARP38934_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "STAT1 Antibody - C-terminal region (ARP38934_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "STAT1 Antibody - C-terminal region (ARP38934_P050)"?

    This target may also be called "DKFZp686B04100, ISGF-3, STAT91, CANDF7" in publications.

  5. What is the shipping cost for "STAT1 Antibody - C-terminal region (ARP38934_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "STAT1 Antibody - C-terminal region (ARP38934_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "STAT1 Antibody - C-terminal region (ARP38934_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "87kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "STAT1 Antibody - C-terminal region (ARP38934_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "STAT1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "STAT1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "STAT1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "STAT1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "STAT1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "STAT1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:STAT1 Antibody - C-terminal region (ARP38934_P050)
Your Rating
We found other products you might like!