Search Antibody, Protein, and ELISA Kit Solutions

STAP2 Antibody - N-terminal region (ARP74268_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74268_P050-FITC Conjugated

ARP74268_P050-HRP Conjugated

ARP74268_P050-Biotin Conjugated

Gene Symbol:
STAP2
NCBI Gene Id:
55620
Swissprot Id:
Q9UGK3
Alias Symbols:
STAP2, BKS,
Replacement Item:
This antibody may replace item sc-514716 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes the substrate of breast tumor kinase, an Src-type non-receptor tyrosine kinase. The encoded protein possesses domains and several tyrosine phosphorylation sites characteristic of adaptor proteins that mediate the interactions linking proteins involved in signal transduction pathways. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
403
Molecular Weight:
44kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express STAP2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express STAP2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human STAP2
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: DFQHVEKLNLGAFEKLTDEIPWGSSRDPGTHFSLILRDQEIKFKVETLEC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Dlg4; MLH1; MYD88; IKBKB; CHUK; PTK2; CSF1R; CBL; STAT5B; PTK6; STAT5A; SRC; JAK2; BMP4; STAT3;
Blocking Peptide:
For anti-STAP2 (ARP74268_P050) antibody is Catalog # AAP74268
Datasheets/Manuals:
Printable datasheet for anti-STAP2 (ARP74268_P050) antibody
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...