Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP74268_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP74268_P050-FITC Conjugated

ARP74268_P050-HRP Conjugated

ARP74268_P050-Biotin Conjugated

STAP2 Antibody - N-terminal region (ARP74268_P050)

Catalog#: ARP74268_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-514716 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human STAP2
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: DFQHVEKLNLGAFEKLTDEIPWGSSRDPGTHFSLILRDQEIKFKVETLEC
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-STAP2 (ARP74268_P050) antibody is Catalog # AAP74268
Datasheets/ManualsPrintable datasheet for anti-STAP2 (ARP74268_P050) antibody
Target ReferenceN/A
Gene SymbolSTAP2
Alias SymbolsSTAP2, BKS,
NCBI Gene Id55620
Description of TargetThis gene encodes the substrate of breast tumor kinase, an Src-type non-receptor tyrosine kinase. The encoded protein possesses domains and several tyrosine phosphorylation sites characteristic of adaptor proteins that mediate the interactions linking proteins involved in signal transduction pathways. Alternative splicing results in multiple transcript variants.
Swissprot IdQ9UGK3
Protein Size (# AA)403
Molecular Weight44kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express STAP2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express STAP2.
Protein InteractionsDlg4; MLH1; MYD88; IKBKB; CHUK; PTK2; CSF1R; CBL; STAT5B; PTK6; STAT5A; SRC; JAK2; BMP4; STAT3;
Write Your Own Review
You're reviewing:STAP2 Antibody - N-terminal region (ARP74268_P050)
Your Rating
Aviva Tips and Tricks
Aviva Tissue Tool
Aviva ChIP Antibodies
Assay Development