Catalog No: ARP53526_P050
Price: $0.00
SKU
ARP53526_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-STAMBP (ARP53526_P050) antibody
Product Info
ReferenceRow,P.E., (2007) J. Biol. Chem. 282 (42), 30929-30937
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human STAMBP
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYS
Concentration0.5 mg/ml
Blocking PeptideFor anti-STAMBP (ARP53526_P050) antibody is Catalog # AAP53526 (Previous Catalog # AAPP32067)
Sample Type Confirmation

STAMBP is supported by BioGPS gene expression data to be expressed in Jurkat

Gene SymbolSTAMBP
Gene Full NameSTAM binding protein
Alias SymbolsAMSH, MICCAP
NCBI Gene Id10617
Protein NameSTAM-binding protein
Description of TargetCytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. STAMBP binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression. Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. The protein encoded by this gene binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene.
Uniprot IDO95630
Protein Accession #NP_998787
Nucleotide Accession #NM_213622
Protein Size (# AA)424
Molecular Weight48kDa
Protein InteractionsCHMP1B; CHMP3; GRB2; UBC; TNFRSF1A; GJA1; MAP3K2; VAMP8; SUMO1; NEDD8; CLTC; FDPS; STAM; STAM2; GRAP2; TRIP13; SPG7; CHMP1A; ITGA5; CYP2C9; NTPCR; CHMP5; SMAD7; SMAD6; PJA1; USP28; USP21; CHMP4B; AMN; CTNNBL1; UACA; CHMP4A; MAP2K5; ALAS1; CASR; UBE2S; TRA
  1. What is the species homology for "STAMBP Antibody - N-terminal region (ARP53526_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "STAMBP Antibody - N-terminal region (ARP53526_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "STAMBP Antibody - N-terminal region (ARP53526_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "STAMBP Antibody - N-terminal region (ARP53526_P050)"?

    This target may also be called "AMSH, MICCAP" in publications.

  5. What is the shipping cost for "STAMBP Antibody - N-terminal region (ARP53526_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "STAMBP Antibody - N-terminal region (ARP53526_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "STAMBP Antibody - N-terminal region (ARP53526_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "48kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "STAMBP Antibody - N-terminal region (ARP53526_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "STAMBP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "STAMBP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "STAMBP"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "STAMBP"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "STAMBP"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "STAMBP"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:STAMBP Antibody - N-terminal region (ARP53526_P050)
Your Rating
We found other products you might like!