Catalog No: ARP53683_P050
Price: $0.00
SKU
ARP53683_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-STAG3 (ARP53683_P050) antibody
Product Info
ReferenceBarber,T.D., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (9), 3443-3448
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human STAG3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Zebrafish: 83%
Peptide SequenceSynthetic peptide located within the following region: VPHQVILPALTLVYFSILWTLTHISKSDASQKQLSSLRDRMVAFCELCQS
Concentration0.5 mg/ml
Blocking PeptideFor anti-STAG3 (ARP53683_P050) antibody is Catalog # AAP53683 (Previous Catalog # AAPP30525)
Sample Type Confirmation

STAG3 is supported by BioGPS gene expression data to be expressed in 721_B

SubunitSA-3
Gene SymbolSTAG3
Gene Full NameStromal antigen 3
Alias Symbols-
NCBI Gene Id10734
Protein NameCohesin subunit SA-3
Description of TargetSTAG3 is a meiosis specific component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The meiosis-specific cohesin complex probably replaces mitosis specific cohesin complex when it dissociates from chromatin during prophase I.
Uniprot IDQ9UJ98
Protein Accession #NP_036579
Nucleotide Accession #NM_012447
Protein Size (# AA)1225
Molecular Weight135kDa
Protein InteractionsSMC3; SMC1A;
  1. What is the species homology for "STAG3 Antibody - middle region (ARP53683_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Zebrafish".

  2. How long will it take to receive "STAG3 Antibody - middle region (ARP53683_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "STAG3 Antibody - middle region (ARP53683_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "STAG3 Antibody - middle region (ARP53683_P050)"?

    This target may also be called "-" in publications.

  5. What is the shipping cost for "STAG3 Antibody - middle region (ARP53683_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "STAG3 Antibody - middle region (ARP53683_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "STAG3 Antibody - middle region (ARP53683_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "135kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "STAG3 Antibody - middle region (ARP53683_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "STAG3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "STAG3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "STAG3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "STAG3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "STAG3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "STAG3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:STAG3 Antibody - middle region (ARP53683_P050)
Your Rating