ST8SIA1 Antibody - middle region (ARP85383_P050)

Catalog No: ARP85383_P050

Host: Rabbit
Target Name: ST8SIA1
Sample Tissue: Human K562 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle terminal region of human ST8SIA1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: CCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ST8SIA1 (ARP85383_P050) antibody is Catalog # AAP85383

Target Info

• Gene Symbol: ST8SIA1
• Gene Full Name: ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
• Alias Symbols: GD3S, SIAT8, SIAT8A, SIAT8-A, ST8SiaI
• NCBI Gene Id: 6489
• Protein Name: alpha-N-acetylneuraminide alpha-2,8-sialyltransferase
• Description of Target: Gangliosides are membrane-bound glycosphingolipids containing sialic acid. Ganglioside GD3 is known to be important for cell adhesion and growth of cultured malignant cells. The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce gangliosides GD3 and GT3. The encoded protein may be found in the Golgi apparatus and is a member of glycosyltransferase family 29. Alternatively spliced transcript variants have been found for this gene.
• Uniprot ID: Q92185
• Protein Accession #: NP_001291379.1
• Nucleotide Accession #: NM_001304450.1
• Protein Size (# AA): 356
• Molecular Weight: 39 kDa