ST6GAL1 Antibody - middle region (ARP81211_P050)

Catalog No: ARP81211_P050

Host: Rabbit
Target Name: ST6GAL1
Sample Tissue: Human Hela Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ST6GAL1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: YHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ST6GAL1 (ARP81211_P050) antibody is Catalog # AAP81211

Target Info

• Gene Symbol: ST6GAL1
• Gene Full Name: ST6 beta-galactosamide alpha-2,6-sialyltranferase 1
• Alias Symbols: ST6N, SIAT1, ST6GalI
• NCBI Gene Id: 6480
• Protein Name: beta-galactoside alpha-2,6-sialyltransferase 1
• Description of Target: This gene encodes a member of glycosyltransferase family 29. The encoded protein is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein, which is normally found in the Golgi but can be proteolytically processed to a soluble form, is involved in the generation of the cell-surface carbohydrate determinants and differentiation antigens HB-6, CD75, and CD76. This gene has been incorrectly referred to as CD75. Three transcript variants encoding two different isoforms have been described.
• Uniprot ID: P15907
• Protein Accession #: NP_003023.1
• Nucleotide Accession #: NM_003032.2
• Protein Size (# AA): 406
• Molecular Weight: 44 kDa