- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for ST14 Antibody (OAAL00317) |
|---|
| Predicted Species Reactivity | Human, Mouse |
|---|---|
| Product Format | Liquid |
| Clonality | Monoclonal |
| Clone | 2F4 |
| Isotype | IgG2a Kappa |
| Host | Mouse |
| Application | Enzyme-linked immunosorbent assay |
| Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
| Immunogen | ST14 (NP_068813, 298 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Peptide Sequence | PPSYNLTFHSSQNVLLITLITNTERRHPGFEATFFQLPRMSSCGGRLRKAQGTFNSPYYPGHYPPNIDCTWNIEVPNNQHVKVRFKFFYLLEPGVPAGTCPKD |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Symbol | ST14 |
|---|---|
| Gene Full Name | ST14 transmembrane serine protease matriptase |
| Alias Symbols | ARCI11;CAP3;channel-activating protein 3;HAI;membrane-type serine protease 1;MTSP1;MT-SP1;prostamin;PRSS14;serine protease 14;serine protease TADG-15;SNC19;suppression of tumorigenicity 14 (colon carcinoma);suppression of tumorigenicity 14 (colon carcinoma, matriptase, epithin);suppressor of tumorigenicity 14 protein;TADG15;TMPRSS14;tumor associated differentially expressed gene 15 protein. |
| NCBI Gene Id | 6768 |
| Protein Name | Homo sapiens suppression of tumorigenicity 14 (ST14), mRNA|suppressor of tumorigenicity 14 protein [Homo sapiens] |
| Description of Target | The protein encoded by this gene is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis. [provided by RefSeq |
| Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/NP_068813 |
| Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/NM_021978 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "ST14 Antibody (OAAL00317)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "ST14 Antibody (OAAL00317)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "ST14 Antibody (OAAL00317)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "ST14 Antibody (OAAL00317)"?
This target may also be called "ARCI11;CAP3;channel-activating protein 3;HAI;membrane-type serine protease 1;MTSP1;MT-SP1;prostamin;PRSS14;serine protease 14;serine protease TADG-15;SNC19;suppression of tumorigenicity 14 (colon carcinoma);suppression of tumorigenicity 14 (colon carcinoma, matriptase, epithin);suppressor of tumorigenicity 14 protein;TADG15;TMPRSS14;tumor associated differentially expressed gene 15 protein." in publications.
-
What is the shipping cost for "ST14 Antibody (OAAL00317)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "ST14 Antibody (OAAL00317)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "ST14 Antibody (OAAL00317)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "ST14 Antibody (OAAL00317)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "ST14"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "ST14"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "ST14"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "ST14"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "ST14"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "ST14"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
