Search Antibody, Protein, and ELISA Kit Solutions

ST14 Antibody - middle region (ARP74850_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
ST14
Official Gene Full Name:
suppression of tumorigenicity 14
NCBI Gene Id:
6768
Protein Name:
Suppressor of tumorigenicity 14 protein
Swissprot Id:
Q9Y5Y6
Protein Accession #:
NP_068813.1
Nucleotide Accession #:
NM_021978.3
Alias Symbols:
HAI, MTSP1, SNC19, ARCI11, MT-SP1, PRSS14, TADG15, TMPRSS14
Replacement Item:
This antibody may replace item sc-170663 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis.
Protein Size (# AA):
855
Molecular Weight:
94 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ST14.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ST14.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human ST14
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: YRCLNGLCLSKGNPECDGKEDCSDGSDEKDCDCGLRSFTRQARVVGGTDA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ST14 (ARP74850_P050) antibody is Catalog # AAP74850
Datasheets/Manuals:
Printable datasheet for anti-ST14 (ARP74850_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...